SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018225362.1.98194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018225362.1.98194
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-73
Family Capz alpha-1 subunit 0.00000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018225362.1.98194
Sequence length 284
Comment hypothetical protein T552_02304 [Pneumocystis carinii B80]; AA=GCF_001477545.1; RF=representative genome; TAX=1408658; STAX=4754; NAME=Pneumocystis carinii B80; strain=B80; AL=Contig; RT=Major
Sequence
MTISIYDLIKDSPPGEVNDVFNGNYIYIYVYVFNRTIDIRILVNNDKSFFEEIVPCLERY
NKEQFTNIKIPGSEDETIISQFNYEDGRFFDPISKKSFIFNHLDLQVSDVQPYEIDEKIS
ERINDLLKPLLIYLSEHFPSSVNYGIFPGKNDTYYIIIVGNKYNPVNFWNGRWRSFYQFS
ESSPVITATLRIDVHYYEDGNVRLTTNHESSFEAKSTNGSDIIAAIAEQEKKYQEELNMT
FHGLNDHDFKSLRRQLPMTKQKINWENISSLKIGQDMAGRNQTY
Download sequence
Identical sequences A0A0W4ZG26
XP_018225362.1.98194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]