SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018247037.1.49799 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018247037.1.49799
Domain Number 1 Region: 13-328
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 7.45e-63
Family ADP-ribosylglycohydrolase 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018247037.1.49799
Sequence length 333
Comment ADP-ribosylglycohydrolase [Fusarium oxysporum f. sp. lycopersici 4287]; AA=GCF_000149955.1; RF=representative genome; TAX=426428; STAX=5507; NAME=Fusarium oxysporum f. sp. lycopersici 4287; strain=4287; AL=Chromosome; RT=Major
Sequence
MPSSQNKSELSPRESRVIGALLGVHAGDSLGATLEFKTHTDIAREYPLGLREIVGGGPFR
WSQGHATDDTDMTRGVLLAYHDYKAGDDVAHLAGDYFISWLHGDWPGRRPGSRPEDIGGA
TATGLMRYEQTQDPDRAGAGEGSAGNGSLMRCIPTGLFQRDPQKLVEESVRISKITHDDK
RCTVACAAYNTIVSKLIDQVAPQEAIEAGLQVAETLEVGYGPVYQSIELGKSLNIATMAA
KGPVPELGGRCSGYVLESLSLAIAAVLDTRSLEDIVVDVVRIGWDTDTNGAIAGGILGAR
DGAAAIPPQWRSVLQFGREFENTALSIFEKKAA
Download sequence
Identical sequences A0A0D2Y078
FOXG_09666T0 XP_018247037.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]