SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018408384.1.44173 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018408384.1.44173
Domain Number 1 Region: 22-281
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-55
Family YWTD domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-55
Family YWTD domain 0.00000564
Further Details:      
 
Domain Number 3 Region: 332-562
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-49
Family YWTD domain 0.00000248
Further Details:      
 
Domain Number 4 Region: 935-1194
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-39
Family YWTD domain 0.0000743
Further Details:      
 
Domain Number 5 Region: 1287-1322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 6 Region: 1246-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 589-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 891-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000873
Family EGF-type module 0.019
Further Details:      
 
Domain Number 9 Region: 286-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000478
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 10 Region: 1325-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000707
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 11 Region: 1204-1256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000795
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018408384.1.44173
Sequence length 1606
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Nanorana parkeri]; AA=GCF_000935625.1; RF=representative genome; TAX=125878; STAX=125878; NAME=Nanorana parkeri; AL=Scaffold; RT=Major
Sequence
MGALLDVLLVVLSTLVCVRASPLLLFANRRDVRLVDAGGTKSDSMVVVSGLEDAAAVDFF
YSQGLIYWTDVSEESIKGILYNQSKSLQHVIISGLVSPDGLACDWIGKKLYWTDSETNRI
EVANLNGTYRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGMDGSMRKIIVDS
EIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLAGDTLYW
TDWQTRSIHACNKQTGEKRREILSALYSPMDIQVFSPERQPYFHTPCEDNNGGCSHLCLL
SPSDPFYTCACPTGVQLTENGKSCKTGADDVLLLARRTDLRRISLDMPDFTDIVLQINDI
KHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSAAQTLVTTEVQHPDGIAVDWVARNLYW
TDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPLTGFMYWTDWGEKPKIESAYLDGS
ERTVLVNTSLGWPNGLALDIQEGKLYWGDAKTDKIEVMNVDGTMRRVLLEDKLPHIFGFT
LLGDHIYWTDWQRRSIERVHKVRASREIIIDQLPDLMGLKAASVTNTFGTNPCADNNGGC
SHLCFFTPRAIRCSCPMGLELLGDMKTCIIPEAFLVFTSRAAIHRISLETNNNNVAIPLT
GVKEASALDFDVSDNMIYWTDITLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNL
YWADTGTNRIEVSRLDGQFRQVLVWKDLDNPRSLALDPAKGYMYWTEWGGKPRIVRAYMD
GTNIITLVDKLGRANDLTIDYADQRLYWTDLDTNMIQSSNMLGQDREIIADDLPHPFGLT
QYSDFIYWTDWNLHSIERADKVNGKNRTLIQGRLDFVMDILVFHSSRQDGTNECMQNNGH
CAQLCLAAPNGYRCSCSSHYTLDSNHRNCSLPTSFLLFSQKTAINRMLVDEQQSPDIILP
IHGLRNVKAISYDPVDKLIYWVDGRQNVIKRVKDDGTQPLAVVSTPNQSQTQEKQPHDLS
IDVYSRTLYWTCETNNSIYVNRLTGEYIGVVLRGENDKPRALALNAERGYMYFTNIQERT
ARIERAALDGTEREVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESSDLTGANRITLE
DSNILQPMGLTVLGDHLYWIDRQQQMIERVEKTNGLQRTRIQGRIAHLTGIHAVESLDIT
EFSAHPCSRDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPEQFTCATGE
IDCIPLSWRCDGFSECEDMSDEEKCPLCSPNQFQCEKGQCIDSRKKCNGEYDCQDKSDEL
NCESICLLTQFRCDNGQCVLSKQQCDTFLECSDNSNNIMCEMSKSSSEETPSHTSAILPV
IGIILSVFVFGGVYFVCQRVVCQRYTGPNGPFPHEYISGTPHVPLNFMTTRGSQPGTYTG
IQCGKQMISSMSIIGGGSSGAPLYDRNHVTGASSSSSSSTKATLYPQILNPPPSPATDRS
LYNTEVFYSSNSPSTTRSYRPYLIRGIVPPTTPCSTDVCDSDYTTSRWKSNKYYVDLNSD
SDPYPPPPTPRSQYMSAEESCPPSPTTERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_018408384.1.44173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]