SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018419823.1.44173 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018419823.1.44173
Domain Number 1 Region: 26-277
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.34e-90
Family Calponin-homology domain, CH-domain 0.000000773
Further Details:      
 
Domain Number 2 Region: 2223-2340
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-37
Family Pleckstrin-homology domain (PH domain) 0.00000426
Further Details:      
 
Domain Number 3 Region: 294-414
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-35
Family Spectrin repeat 0.0000537
Further Details:      
 
Domain Number 4 Region: 601-740
Classification Level Classification E-value
Superfamily Spectrin repeat 5.64e-32
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 1009-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-29
Family Spectrin repeat 0.0000231
Further Details:      
 
Domain Number 6 Region: 1221-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-29
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 7 Region: 1540-1693
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 1856-2010
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 812-949
Classification Level Classification E-value
Superfamily Spectrin repeat 7.56e-24
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 10 Region: 423-526
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-23
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 11 Region: 1697-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 744-846
Classification Level Classification E-value
Superfamily Spectrin repeat 2.72e-22
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 13 Region: 527-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 14 Region: 1382-1480
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 15 Region: 2015-2076
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000127
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018419823.1.44173
Sequence length 2393
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X1 [Nanorana parkeri]; AA=GCF_000935625.1; RF=representative genome; TAX=125878; STAX=125878; NAME=Nanorana parkeri; AL=Scaffold; RT=Major
Sequence
MTAVATDFDNIDIQQQYSDVNNRWDDEWDNENSSARLFERSRIKALADEREAVQKKTFTK
WVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQF
LKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLW
CQMKSAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAE
QHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLENAIETEK
MIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNL
EVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQ
LARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVV
AVARELETENYHDIKRITARKDNVIRLWEYLLELLRARRLRLEMNLGLQKVFQEMLYIMD
WMDEMKVLLLSQDYGKHLLGVEDLLQTHALVESDIAIQADRVRAVNASAQKFAVGGEGYK
PCDPQIIRDRISHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILS
SDDYGKDLTSVVRLLSKHKAFEDEMSGRSGHLLQTIKEGEEMIAEEHFGSEKIRERIKDI
QEQWANLEHLSAIRKKRLEETSSFHQFQADADDIDAWMLDILRIVSSNDVGHDEYSTQSL
VKKHKDVAEEIANYRTTIDALHEQAAALPQEQFESNEVQIRLSGMEERYKELVELARLRK
QALQDALTLYKMFSEVDACELWIVEKEQWLNHLQIPEKLEDLEVIQHRFESLEPEMNNQA
SRVAVVNQIARQLIHSGHPSESEIKGQQEKLNIRWGQFRELVDKTKDALSSVLSIQNYHL
ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKL
EAEHPDQAQAIMSRLAEINDVWEEMKTTLKNREESLGEASKLQKFLRDLDDFQSWLSRTQ
TVIASEDMPNTLAEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQ
RLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPNILE
AAEAAIKKQEDFMTTMDASEEKINAVVDTGRRLVKDGNINSDKIEEKVDSIDSRHMKNRE
TAKDLVSRLKDNREMQEFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAE
LASNKEWLDKIEKEGNQLIAEKPETEPIVREKMTGLQEMWEELETTTQTKAQRLFDANKA
ELFTQSCADLDKWLHGLESQIQSDDFGKDLTSVNILLKKQQMLEKQMDVRKKEVEELQSQ
AQALSQEGKSPDEVDGQRIVVEKRFVELMAPLTERKKYLLASKEIHQFNRDVEDEILWVE
ERMPLATSTDHGHNLQTVQLLYKKNQTLQKEIQGHQHRSDEIFERSQKILEDGSLNAEAI
QQRLSDLQALWNLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKD
EQSAVSMLKKHQILEQAVEDYADAVHQLSKTSRSLVADGHPESERISMRQSQVDKLYAGL
KDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREF
ARDTGHIGQERVDTVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAA
SYELHKFYHDAKEILGRIQDKQKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL
QEDATRLQAAYAGDKADDIQKRESEVLEAWKALLDACEGRRLRLVDTGDKFRFFSLVRDL
MLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARQHY
ATEEIKEKLLQLTEKRKDMIDKWEDRWEWLRLILEVHQFSRDACVAEAWLLGQEPYLSSR
EIGQSVAEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKRKPPTP
ELSPKVSEEDSPQQWDGKEEQISQNGLPSDQDSPRMELESTVGLYSDGAHTAEQVHEFVP
DEPQSPPLVNMGENAETNEMVNGSTEQRSSSKESSPVPSPTADRKSKSGMQPQTAATLPA
KTQDIPSAQFEGTLHRKHEWETHNKKASNRSWHNVYCVINNQELGFYKDAKSASSGIPYH
NEVPVNLKEAACEVATDYKKKKHVFKLKLNDGNEYLFQAKDDEEMNTWIQAITNAISSDK
TEVSLSTQSTPASSRAQTMPASVTVTTESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences XP_018419823.1.44173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]