SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018419824.1.44173 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018419824.1.44173
Domain Number 1 Region: 25-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-90
Family Calponin-homology domain, CH-domain 0.000000959
Further Details:      
 
Domain Number 2 Region: 2213-2330
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-37
Family Pleckstrin-homology domain (PH domain) 0.00000426
Further Details:      
 
Domain Number 3 Region: 284-404
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-35
Family Spectrin repeat 0.0000537
Further Details:      
 
Domain Number 4 Region: 591-730
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-32
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 999-1154
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-29
Family Spectrin repeat 0.0000231
Further Details:      
 
Domain Number 6 Region: 1211-1364
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-29
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 7 Region: 1530-1683
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 1846-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 802-939
Classification Level Classification E-value
Superfamily Spectrin repeat 7.56e-24
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 10 Region: 413-516
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-23
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 11 Region: 1687-1790
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 734-836
Classification Level Classification E-value
Superfamily Spectrin repeat 2.56e-22
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 13 Region: 517-625
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 14 Region: 1372-1470
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 15 Region: 2005-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000125
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018419824.1.44173
Sequence length 2383
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X2 [Nanorana parkeri]; AA=GCF_000935625.1; RF=representative genome; TAX=125878; STAX=125878; NAME=Nanorana parkeri; AL=Scaffold; RT=Major
Sequence
MELQRTSSLSGPLSSPVHTAQVPFNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARVS
CRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLEN
MGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKSAGYPN
VNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLD
PEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLENAIETEKMIEKYESLAS
DLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSK
MRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAA
MRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELETEN
YHDIKRITARKDNVIRLWEYLLELLRARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLL
SQDYGKHLLGVEDLLQTHALVESDIAIQADRVRAVNASAQKFAVGGEGYKPCDPQIIRDR
ISHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTS
VVRLLSKHKAFEDEMSGRSGHLLQTIKEGEEMIAEEHFGSEKIRERIKDIQEQWANLEHL
SAIRKKRLEETSSFHQFQADADDIDAWMLDILRIVSSNDVGHDEYSTQSLVKKHKDVAEE
IANYRTTIDALHEQAAALPQEQFESNEVQIRLSGMEERYKELVELARLRKQALQDALTLY
KMFSEVDACELWIVEKEQWLNHLQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIA
RQLIHSGHPSESEIKGQQEKLNIRWGQFRELVDKTKDALSSVLSIQNYHLECNETKSWIR
EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQA
IMSRLAEINDVWEEMKTTLKNREESLGEASKLQKFLRDLDDFQSWLSRTQTVIASEDMPN
TLAEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWN
ELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPNILEAAEAAIKKQE
DFMTTMDASEEKINAVVDTGRRLVKDGNINSDKIEEKVDSIDSRHMKNRETAKDLVSRLK
DNREMQEFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDK
IEKEGNQLIAEKPETEPIVREKMTGLQEMWEELETTTQTKAQRLFDANKAELFTQSCADL
DKWLHGLESQIQSDDFGKDLTSVNILLKKQQMLEKQMDVRKKEVEELQSQAQALSQEGKS
PDEVDGQRIVVEKRFVELMAPLTERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTD
HGHNLQTVQLLYKKNQTLQKEIQGHQHRSDEIFERSQKILEDGSLNAEAIQQRLSDLQAL
WNLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKK
HQILEQAVEDYADAVHQLSKTSRSLVADGHPESERISMRQSQVDKLYAGLKDLSEERRGK
LDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQE
RVDTVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHD
AKEILGRIQDKQKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDATRLQAA
YAGDKADDIQKRESEVLEAWKALLDACEGRRLRLVDTGDKFRFFSLVRDLMLWMEDVIRQ
IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARQHYATEEIKEKLL
QLTEKRKDMIDKWEDRWEWLRLILEVHQFSRDACVAEAWLLGQEPYLSSREIGQSVAEVE
KLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKRKPPTPELSPKVSEED
SPQQWDGKEEQISQNGLPSDQDSPRMELESTVGLYSDGAHTAEQVHEFVPDEPQSPPLVN
MGENAETNEMVNGSTEQRSSSKESSPVPSPTADRKSKSGMQPQTAATLPAKTQDIPSAQF
EGTLHRKHEWETHNKKASNRSWHNVYCVINNQELGFYKDAKSASSGIPYHNEVPVNLKEA
ACEVATDYKKKKHVFKLKLNDGNEYLFQAKDDEEMNTWIQAITNAISSDKTEVSLSTQST
PASSRAQTMPASVTVTTESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences XP_018419824.1.44173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]