SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018424421.1.44173 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018424421.1.44173
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-56
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 180-418
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-52
Family YWTD domain 0.00000274
Further Details:      
 
Domain Number 3 Region: 784-1042
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-38
Family YWTD domain 0.00004
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-26
Family YWTD domain 0.000046
Further Details:      
 
Domain Number 5 Region: 1173-1210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1095-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1135-1170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 738-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.006
Further Details:      
 
Domain Number 10 Region: 132-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000221
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 11 Region: 1052-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000957
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018424421.1.44173
Sequence length 1452
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6 [Nanorana parkeri]; AA=GCF_000935625.1; RF=representative genome; TAX=125878; STAX=125878; NAME=Nanorana parkeri; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGTLRAIIIDSDIYWPNGLTLDYEEQKLYWADAKLSFIHKSNL
DGTFRQTVVKGSLPHPFALTLFRDTIFWTDWTTHSILACNKYTGEERREVDTNIFSPMDI
HVFSQMRQPNATNPCAGHNGGCSHLCLMSPTEPFYHCACPTGVRLKDDGKTCMHGATELL
LLARRTDLRRISLDTPDFTDIVLPLDDIRHAIAIDYDPVEGYIYWTDDEVQAIRRAQVDG
SSSQFIVVSQVSHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAI
VLDPINGCMYWTDWGENPKIERAAMDGSDRVILVNTSLGWPNGLALDYTEGKIYWGDAKT
DQIEVMNMDGSGRRLLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKHTGEREVIIDQ
LPDLMGLKATNIHKLPGTNACADNNGGCSHLCLYRPQGPRCACPIGLELINDMRTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVQFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGMHRQILVWKDLDSPR
ALALDPADGFMYWTEWGGKPKIDRASMDGSERITLVPNVGRANGLTIDYAERRLYWTDLD
TNLIESSNMMGQDREVIADDLPHPFGLTQYQDFIYWTDWSLRSIERANKTSGQNRTIIQD
HLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLATPVIGYTCGCPVHYSLNTDNKTCSA
PSSFLLFSQRNAINRMVIDEQQSPDIILPIHNLRNVRAIDYDPVEKHLYWIDSRQTIRRA
LEDGSQNVTVVSNTNTNQNLDMQPYDMSIDIYSRFIYWTCEATNVINVTRMDGRAVGVVL
KGDQDRPRAILVNPERGYMYFTNLQERSAKIERAALDGTEREILFFTGLSKPIALALDNK
LGKLFWADSDLRRIESSDLSGGNRIVLEDSNVLQPVGLTVFGNHLYWIDRQQQMIERIEK
TGHEGCTKIQARIQFLTDIHAVTELSMQEYKEHPCSQDNGGCSHICIVKGDGTTRCSCPM
HLVLLQDELSCGEPPTCSPQQFTCYTGEVDCIPAEWRCDGFTECVDHSDEQNCPMCSDTQ
FQCASGQCIDSSLRCNGDANCQDKSDEKNCDEICTPEQFHCGSGQCISKHRRCDHKRDCS
DSSDELGCXEPPPPSTNTIGSIIGVILTVFVVGGVYFVCQRVLCPRMKGDGETMANDYVV
HGPASVPLGYVPHPSSLTGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSS
TKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYRPYSYRHFAPPTTPCSTDVC
DSDYTPSHRLTSATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEESCPPSPYTERSYSHHL
YPPPPSPCTDSS
Download sequence
Identical sequences XP_018424421.1.44173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]