SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018530413.1.34915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018530413.1.34915
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-55
Family YWTD domain 0.00000418
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-54
Family YWTD domain 0.00000212
Further Details:      
 
Domain Number 3 Region: 332-567
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-52
Family YWTD domain 0.00000372
Further Details:      
 
Domain Number 4 Region: 936-1197
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.000041
Further Details:      
 
Domain Number 5 Region: 1329-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 7 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000486
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 588-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1288-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000127
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 286-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018530413.1.34915
Sequence length 1626
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6 [Lates calcarifer]; AA=GCF_001640805.1; RF=representative genome; TAX=8187; STAX=8187; NAME=Lates calcarifer; AL=Scaffold; RT=Major
Sequence
MGVVLRSLLLCSFCFLIRGVPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYVY
SQDLIYWSDVSEEAIKRTVFNQSGAGAVETVVPGLASPDGLACDWLGRKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGYMYWTDWGEIPKIERAGMDGTNRSMIIDR
EIYWPNGLTLDYSQQKLYWADAKHNFIHRSNLDGSSREVVVKGELPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGDEQRIVHSDIFSPMDIHVFSSKRQPALSSPCSVNNGGCSHLCLL
SPVKPFYQCACPTGVQLLEDGKTCRDGATQMLLLARRTDLRRISLDTPDFTDIILQVDDI
RHAIAIDYDPVEGYIYWTDDDVKAIRRSLLDGTDAQFVVTSQVNHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDGM
ERVVMVNTSLGWPNGLALDYDERKIYWGDAKTDKIEVMNMDGTGRRVLVEDKLPHIFGFT
LLGDFIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATHVHQFFGTNPCAENNGGC
SHLCLYKPQGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAMD
GTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQEREVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDIIL
PIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVSSSVGGPSQGLQLYDL
SIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLER
SPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIVI
ADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELDM
REYSKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPEQFSCTSG
EVDCIPQAWRCDGYAECDDKSDEEDCPVCSESEFQCDSRQCIDLSLRCNGEFNCQDRSDE
NKCEGVAVLCPLDQFTCSNGQCIGKHKKCDNNMDCTDNSDEIGCYPTEEPPPPPNTTIGS
IVGVVMALFVVGAVYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSSL
PGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRS
QYTMEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPFKSSAAAA
SAAAAAKGYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPS
PCTDSS
Download sequence
Identical sequences XP_018530413.1.34915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]