SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018608192.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018608192.1.37976
Domain Number 1 Region: 639-894
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-56
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 22-287
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-52
Family YWTD domain 0.00000286
Further Details:      
 
Domain Number 3 Region: 338-585
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-51
Family YWTD domain 0.00000212
Further Details:      
 
Domain Number 4 Region: 941-1199
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-36
Family YWTD domain 0.000061
Further Details:      
 
Domain Number 5 Region: 1251-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 6 Region: 1292-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 896-944
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000173
Family EGF-type module 0.043
Further Details:      
 
Domain Number 8 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 595-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000069
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 10 Region: 292-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 1210-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000285
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018608192.1.37976
Sequence length 1611
Comment PREDICTED: low-density lipoprotein receptor-related protein 5-like isoform X2 [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
MEVRVAGWLLCGAVLCAVRGSPLLLFANRRDVRLVDVEGGRAESTVVVSGLDVVAVDFVF
SEGLIFWTDVSEEAIKQTYYDQSSTVKEATLGSGRTVLAGLDSPDGLACDWLGHKLYWTD
SETNRIEVANMNGSFRKVLFWQDLDQPRAIALNPAHRYMYWTDWGEEPRIERAGMDGSNR
QIIVESNIFWPNGLTIDLEEQKLYWADAKLTFIHRANLDGSLREAVVEGTLTHPFALTLS
GDTLYWTDWQTRSIHACNKETGDKRREVLSGLHSPMDIQVLDKDRQPNVSTPCSHGNGGC
SHLCLLSPMEPFYSCACPTGVRLQDDGKTCRPGAEEVLLLARRTDLRRISLDLPDFTDIV
LQVDDIRNAIAIDYDPVDGHVYWTDDEAKGIRRARIDGSEAQTLVTTEIDHPDGIAVDWV
ARNLYWTDTGPDHIEVTRLNGTSRRILVSENLDEPRAIALDPVRGYMYWTDWGAKPKIER
ACLDGSQRVVLINSSLGWPNGLALDYEAGKLYWGDARTNKIEVININGTDRRTILDDKLP
HIFGFTLLGDYIYWTDWQRRSIERVRKTGAAREMIIDQLPDLMGLKATSVTKAFGTNACA
VDDGGCSHLCLYRPQGPQCACPMGLELLSDLSTCVVPEAFLLFTHRANIRSISLGTNGNN
VAIPLTGVKEASALDFDVAENRIYWTDISTKTISRAFMNGSSVEHVIEFGLDYPEGMAVD
WMGRNIYWADTGTNRIEVARLDGQYRQVLVCKDLDNPRALALDPANGYMYWTEWGGKPRI
ARAYMDGHNITTLVDKVGRANGLTIDHMDQRMYWTDLDTCMIESSDMLGQQRATVADDLP
HPFGLTQYRDYIYWTDWNLRSIVRADKRSGLNRTLIQGQLDYVMDILVFHASRQSGSNEC
SHGNGQCAHLCLATPEGSRCRCASHYSLDPNGKNCISPSSFLLFSQKASISRMVLGEQSL
DIILPIHVMRNVRVIRYDPLERFIYWVDGRQNIRRARDDGSESFVVVSNTPGQQQNLEKQ
PHDFSLDPYSRSLFWTCEITNTINAHRLDGVFVGVILKDDVDKPRAIVVNAERGYMYFTT
VQEHSAKIERASLDGTERESLFTTGLIRPVALTLDNQLGKLFWADADLKRIESSDFSGAN
RITLQDSNILQPVGLTVLGEHLYWIDRQQQMIERVDKLTGEKRTRIQGRIVHLTSIYAVE
DVDPEEFASHPCYLDNGGCSHICIAKGDGTPRCSCPMHLVLLQNLLTCGEPPTCSTEQFT
CATGEIVCIPMVWRCDGLAECDDNSDEENCPLCTVHQFQCDKGQCIDAHLRCNGEADCAD
NSDEQDCDTVCLPSQFHCGKNQCIEKKQQCDSYMDCADNSDELFCDMLTAPPRIYQADSS
TVGPVIGIILSVFVMGGMYFVCQRVVCLWYKRPSGAFPHEYISGTPHVPLNFIDPGSSQH
STFAGITCEKSMMSSPSLMGSSNSGAPLYDRTHVTGASSSSSSSSKAAFYPQMLNPPPSP
ATDRSLYNVELFYSSNSPSTIRSYRPYLMRGVAPPTTPCSTDVCDSDYAPSRWKSNKYNM
DLNSDSDPYPPPPTPRSQYLSAEESCPPSPSTEHSYFHLGPPPPSPCTDSS
Download sequence
Identical sequences A0A1W4ZX09
XP_018608192.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]