SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018621144.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018621144.1.37976
Domain Number 1 Region: 551-806
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-55
Family YWTD domain 0.00000444
Further Details:      
 
Domain Number 2 Region: 250-496
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-52
Family YWTD domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 6-199
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-46
Family YWTD domain 0.00000838
Further Details:      
 
Domain Number 4 Region: 853-1112
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-38
Family YWTD domain 0.0000965
Further Details:      
 
Domain Number 5 Region: 1204-1239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 809-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.052
Further Details:      
 
Domain Number 7 Region: 507-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000986
Family EGF-type module 0.006
Further Details:      
 
Domain Number 8 Region: 1164-1202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 204-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 10 Region: 1242-1277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 11 Region: 1120-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018621144.1.37976
Sequence length 1522
Comment PREDICTED: low-density lipoprotein receptor-related protein 5-like [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
MLGSGQSVVVSGLDSPDGLACDWLGRKLYWTDSETNRIEVANLDGSYRKVLFWQDLDQPR
AIALNPAQRYMYWTDWGEEPRIERAGMDGSSRNVIVDTDIYWPNGLTIDLEEQKLYWADA
KLSFIHRANLDGSSREAVVEGTLTHPFALTLSGETLYWTDWQTRSIHACNKQTGDKRREI
LGGIYSPMDIQVLSQDRQPEIHTPCAESNGGCSHLCLLSPVEPFHSCACPTGVRLQDDGK
TCHPGAEEVLLLARRTDLRRISLDLPDFTDIVLQVDDIRHAIAIDYDPVDGHVYWTDDEV
KAIRRARIDGSEAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRRILI
SENLDEPRAIVLDPIGGYMYWTDWGEKPKIERANLDGSERVIMLNSSLGWPNGLALDHMA
GKLYWGDAKTDKIEVINVDGTGRRTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKT
EAVREIIIDQLPDLMGLKASRVTRTFGTNPCAGDNGGCSHLCFHRPQGPRCACPMGLELL
SDLRTCVVPEAFLLFTHRADIRSISLGTNSNDVAIPLTGVKEASALDFDVTENRIYWTDV
STKTISRAFMNGSSLEHVIEFGLDYPEGMAVDWMGRNVYWADTGTNRIEVARLDGQYRQV
LVCKDLDNPRSLALDPANGYMYWTEWGGKPRIARAYMDGSNIITLVDKVGRANGLTIDYV
DQRLYWTDLDTCMIESSNMLGQQREIVADDLPHPFGLTQYRDYIYWTDWNLRSIERADKH
SGQNRTVVQGHLEYVMDILVFHASRQDGSNECSQDNGQCAHLCLATPEGSRCRCASHYTL
EANGRNCSSPSSFLLFSQKTSISRMVLGEQSPDVVLPIHVQRTVRALGYDPLDRLLYWVD
GRQNIRRARDDGSQLFVVVSTTPGHQQSPDKLPHDLSLDPYSRMVYWSCEATNTINVQRL
DGRTVGVVLRDDLDKPRAIVVNAERGYMYFTTTQERAAKIERAALDGTEREALFTTGLIR
PVALALDNKLGKLFWADADLKRIESSDLSGANRITLQDSNILQPMGLTVLGDHLYWIDRQ
QQMIERVDKVTGEKRTRVQYRVVHLTSIHAVEDMDPEEFDSHPCSHDNGGCSHICIAKGD
GTPRCSCPMHLVLLQNLLTCGEPPTCSTEQYTCATGDIDCIPMAWRCDGFTECDDNSDEE
NCPVCTVFQFQCDKGQCIDAQLRCNGELDCADSSDEQNCQNICFPTQFRCGNQCIEKKQQ
CDSYADCDDNSDELYCEVPLSPSNELPSHTSTIGPVIGIILSVFLMGGVYFVCQRVVCRR
YKGPSGAFPHEYISGTPHVPLNFIAPGNTQHGTFTGISCGKSMMSSVSLMGSSSSGAPLY
DRNHVTGASSSSSTSTKAAYYPQMLNPPPSPATDRSLYNAEMFYSSNSPSTTRSYRPYLM
RGVAPPTTPCSTDVCDSDYTTSRWKSNKYYMDLNSDSDPYPPPPTPRSQYLSAEESCPPS
PSTERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences A0A1W5B0D7
XP_018621144.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]