SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018621508.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018621508.1.37976
Domain Number 1 Region: 482-737
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-55
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 181-415
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-49
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 3 Region: 785-1047
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-41
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-26
Family YWTD domain 0.0000599
Further Details:      
 
Domain Number 5 Region: 1176-1214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 6 Region: 1098-1136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 740-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 437-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 9 Region: 1138-1174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000283
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 11 Region: 1055-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000754
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018621508.1.37976
Sequence length 1462
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
MYWTDWGEIPKIERAGMDGSSRSIIVDSEIYWPNGLTLDYTELKLYWADAKYNFIHRSSL
DGSLREVVVKGSLPHPFALTLYQDTLFWTDWNTHSIHSCNKKTGEDRQEVHTNIFSPMDL
HVYSEDRQPLALMNPCTLKNGNCSHLCLLSPTKPFYQCACPTGVQLLEDGRTCREGATQL
LLLARRTDLRRISLDTADFTDIVLNTEDIRHAIAIDYDPVEGHVYWTDDDVRAIRRSYLD
GSGSQFLVTSQVHHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRA
IVLDPVAGYMYWTDWGEVPKIERAALDGTDRVIMVNTSLGWPNGLALDYGERKLYWGDAK
TDKIEVINMDGTERRILVEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKHSAEREIIVD
QLPDLMGLKATYVHQVFGTNPCAENNGGCSHLCLYKPQGVQCACPIGLELISDMSTCIVP
EAFLLFSRHTDIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDITLKTISRAF
MNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSP
RALALDPAEGFMYWTEWGGKPKIDRAAMDGTGRTTLVDNVGRANGLTIDYAARRLYWTDL
DTTLIESSNMLGLEREVIADDLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTVIQ
GHLDYVMDILVFHSSRQGGWNACASTNGHCSHLCLAVPVSGFVCGCPAHFTLNSDNKTCS
APTSFLLFSQKTAINRMVIDEQQSPDIVLPIHSLRNVRAIDYDPLHKHLYWIDVKQNVIR
RAQEDGNQSMAVVSSTPGMNSGLGLQPFDLSLDIYSRYIYWTSEVTNVINVTTMDGRRVG
VVLRGEQDKPRGIVVNPERGYMYFTNLQERSPKIERAALDGTEREVLFFTGLGRPVALTL
DNEAGKLFWADTDLRRIESSDLSGANRIVIEDSNILQPVGLTVFGNHLYWIDRQQQMIER
IDKTTREGRTKIQARISSLSDIHAVHELDMKEYSKHPCTSDNGGCSHICIVKGDGTTRCS
CPVHLVLLQDELSCGEPPTCSPEQFSCASGEVDCIPHAWRCDGYAECDDGSDEYDCPVCS
EMEFQCDSRQCVALALRCNGEPNCQDASDESKCSVRCPPDKFRCSNGQCIGRHKKCDHNM
DCSDNSDEIGCYPTEDPPPQPVSVIGSIVGVILALFVVGAVYFVCQRVLCPHMKDDGATM
ANDFVVHGPSSVPLGYVPHPNSLSGSLPGMSRGKSVMSSLSIMGGSSGPPYDRAHVTGAS
SSSSSSTKGTYFPPMLNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYTYRHFAPPT
TPCSTDVCDSDYTPGRRIIPVAKGYASDFNYDSEPFPPPPTPRSQYLSAEENYESCPPSP
YTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A1W5B6C3
XP_018621508.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]