SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018644253.1.29077 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018644253.1.29077
Domain Number 1 Region: 85-179
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-28
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 2 Region: 6-61
Classification Level Classification E-value
Superfamily L27 domain 5.89e-24
Family L27 domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018644253.1.29077
Sequence length 193
Comment lin-7-like proteins [Schistosoma mansoni]; AA=GCF_000237925.1; RF=representative genome; TAX=6183; STAX=6183; NAME=Schistosoma mansoni; strain=Puerto Rico; AL=Chromosome; RT=Major
Sequence
MAESLSLQRDINRVLELLEILQRCPEIQPSKLAALQRILQSDFCDMIREVYEHIYTTVDI
NGSEEVKASATAKATVAAFAASEGHAHPRVIELPKTNEGLGFNVMGGKEQNSPIYISRII
PGGVADRHGGLKRGDQLLSVNGISVESEHHERAVELLKLAQGTVKLVVRYTPRILEEMEA
RFDKQKARRRQLN
Download sequence
Identical sequences A0A183QZ91 C4QC83
Smp_055600 XP_018644253.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]