SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018682344.1.42102 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018682344.1.42102
Domain Number 1 Region: 332-443
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000103
Family Ankyrin repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018682344.1.42102
Sequence length 620
Comment PREDICTED: ankyrin repeat protein SKIP35 [Musa acuminata subsp. malaccensis]; AA=GCF_000313855.2; RF=representative genome; TAX=214687; STAX=4641; NAME=Musa acuminata subsp. malaccensis; strain=Doubled-haploid Pahang (DH-Pahang); AL=Chromosome; RT=Minor
Sequence
MEVECKTVMTREDCMHLVQERQPEKDFDENGGLRAVHDGDEGEKVDGSNVVLLPLPADDH
RISKDYACDGMKVGSRASNPLEELAVQTKEQGKNKQGKKLSRRDRMELGRLFQEAVSSHD
WELAESLVLLADSQTLNDVLCIALDAIWFLTTWGELNGITGLIKKIVSYGGSDFTRAILR
TSFFASCVYACHCRIMNLTDTVGIMAQRLHERLQECHGDEVLKAEAGMKVQKFTDWALKC
IGFHFRYQENRGGRKNNMIVEVQLQLSAFKTFLELAGDHLTGKDFTEAFDAACFPLTLFS
SSFDSGWALGISAIAVQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAERNSLD
IDVDLALVFASHYCKIGTMECLVDEGHAVDFLGPLVRASERGCMQVVQWFVNRGCGDMEL
CLALTAATSSSQVGVSAYLLPHIPQHVLAALSIEILKAAGERSRGSLDGVAFLLCSDFLG
DPAATYAVADSIARSNDEAVAPELRAFLLEQWSEAAFAEGLSSGQDHFVNFMRILRRGCS
PICLMDLPPPLAATIAYMPLYRECMEAGGQLLSQKLRGQLVEAARRIGGRWVDDDSQANE
LLEILERNLPRFFLQPLTTL
Download sequence
Identical sequences M0T823
XP_009404918.1.42102 XP_018682344.1.42102 GSMUA_Achr6P18250_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]