SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018711120.1.9870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_018711120.1.9870
Domain Number - Region: 28-66
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.0366
Family Frataxin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018711120.1.9870
Sequence length 68
Comment hypothetical protein METBIDRAFT_32577 [Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993]; AA=GCF_001664035.1; RF=representative genome; TAX=869754; STAX=27322; NAME=Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993; strain=NRRL YB-4993; AL=Scaffold; RT=Major
Sequence
MSEQEQEKIIKTLEEEDEFEDFPEDAQWTSEPNSQLNSANLWEEDWDDDDDNDEFTEKLR
EELKKAQK
Download sequence
Identical sequences A0A1A0H9P3
XP_018711120.1.9870 jgi|Metbi1|32577|fgenesh1_kg.4_#_359_#_Locus413v1rpkm486.88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]