SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018763348.1.15306 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018763348.1.15306
Domain Number 1 Region: 517-772
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 216-446
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-50
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 819-1078
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-39
Family YWTD domain 0.0000588
Further Details:      
 
Domain Number 4 Region: 18-165
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-30
Family YWTD domain 0.0000961
Further Details:      
 
Domain Number 5 Region: 1209-1244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1171-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1130-1170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 775-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000343
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 473-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000424
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 170-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1087-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018763348.1.15306
Sequence length 1489
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X2 [Serinus canaria]; AA=GCF_000534875.1; RF=representative genome; TAX=9135; STAX=9135; NAME=Serinus canaria; AL=Scaffold; RT=Major
Sequence
MLGAPSWSPPWWSAAWRTLLPSTSSIHKASFSGQMYMYWTDWGETPRIERAGMDSSMRKI
IVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGD
TLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSH
LCLLSPRDPFYSCACPTGVQLEDDGRTCKAGAEEVLLLARRTDLRRISLDMPDFTDIILQ
IDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGTGAQTLVTTEINHPDGIAVDWVAR
NLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAY
LDGSERRILVNTSLGWPNGLALDLEKNKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHI
FGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKAFGTNSCAEN
NGGCSHLCFFTPQEARCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVA
IPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWM
GKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVR
AYMDGTNSITLVDKVGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHP
FGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQ
NNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPD
IILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQP
HDLSIDIYSHTLYWTCEATNSVNVQRLSGESIGMVLRGEHDRPRAIVVNAERGYMYFTNM
QERAPKIERAALDGTEREVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANR
VTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEE
LDMEEFSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTC
ATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDK
SDEADCDTICLPNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKSKPASDESQPHSSA
IGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHG
TFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPAT
DRSLYNAEMFYSSNIPSNTRSYRPYLIRGIAPPTTPCSTDVCDSDYTPSRWKANKYYIDL
NSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_018763348.1.15306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]