SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018793252.1.52592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018793252.1.52592
Domain Number 1 Region: 524-715
Classification Level Classification E-value
Superfamily MIR domain 6.28e-54
Family MIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018793252.1.52592
Sequence length 976
Comment PREDICTED: protein O-mannosyltransferase 1 isoform X1 [Bactrocera latifrons]; AA=GCF_001853355.1; RF=representative genome; TAX=174628; STAX=174628; NAME=Bactrocera latifrons; AL=Scaffold; RT=Major
Sequence
MSSIATTVKRRKPLVKSKSKNTTIGTSAVFTVTTSTTTNTLSDPVKNYSANDPFDKATLA
NASSNKRLQRFSLSDILVGIMPRTAKQQTNSNNVSSNTSNSNPTTALILRTTSPTLYNGS
IACCRDVNCRLNALNEHFTALVQQKHHHQCIQRASVCSNASSSSGVSHTKSSRRSRSSTV
TGLSRNETTATPTVPAIAAAALRDGSPDSGVGSDAALAKVFRAAAETTTSGDSTLSSLGQ
YLTVHLQLDLCTWILFILAAFTRFYKLSIPHHVVFDEIHYGKYISLYMRNIFFFDQHPPL
GKQLIAAVAYTAGGYDGNYTFPHIGAEYNKNMPIFWLRFVPALCGSALAPIVYKLLIAAR
LSRWSALLGGILIILDNALLTQSRFILMESMLLLFEACGLYCMLRFQESRFGSSLWLIFG
LASASCFSFASSVKYAGFLTYGLTAYLSCRFLWDKLYDATLSNLHIILQTFGRIVLFTIV
PIMLYIGVFFVHLQLLYRAGPHDSIMTSAFQASLDGGLASITKGQPLKVAHGSQVTLRHT
HGRTCWLHSHTHVYPVRYPDKRGSSHQQQVTCYSFKDVNNWWIIKRPHREDLVVGNELDV
IRHGDIIQLVHGITSRGLNSHDVAAPMTPQCQEVSCYIDYEIKMPGELLWRVEILNRETE
GNIWHAIKSEVRLIHHTTGAALRYSGRQLPEWGFNQHEVVADRSVEHKDAIWNVEEHRYT
KTQDQRERERQLLKAEMIPTKKTKLTFLAKFFELQTKMLWGTKQLDTHMYSSSPLEWPLL
DKGIAYWVDTKTGSQIHLLGNIIIWYTGTAALILYILLNIFYVLRRRRLHFDLPEHEWHR
FRQVGDIFLVAYFIHYLPYFTMDRALFLHNYLPAFLFKLLLLCYVFEHIDYLLRLYCYVN
CKYNVKGTLQPQRIWLVRSYRLGILIWLVYVIWVFIKFLPLTYGMQKLSPQKVISLRWKD
TWDFIIQVHKSTSNRI
Download sequence
Identical sequences A0A0K8UAP7
XP_018793252.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]