SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018864895.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018864895.1.27298
Domain Number 1 Region: 20-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000127
Family I set domains 0.00067
Further Details:      
 
Domain Number 2 Region: 104-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000197
Family I set domains 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018864895.1.27298
Sequence length 279
Comment PREDICTED: high affinity immunoglobulin gamma Fc receptor IB isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYQNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHEK
KVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAK
Download sequence
Identical sequences A0A2I2YE88
ENSGGOP00000016882 ENSGGOP00000016882 XP_004026504.1.27298 XP_018864895.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]