SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018877150.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018877150.1.27298
Domain Number 1 Region: 365-522
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-30
Family Toll/Interleukin receptor TIR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000328
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 25-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000227
Family I set domains 0.054
Further Details:      
 
Weak hits

Sequence:  XP_018877150.1.27298
Domain Number - Region: 128-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000612
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018877150.1.27298
Sequence length 541
Comment PREDICTED: interleukin-18 receptor 1 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MNCRELPLTLWVLIFVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMENYTQKWKLNVIRRNKQSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEIRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDESEVLPVLSE
S
Download sequence
Identical sequences G3RAT7
ENSGGOP00000012565 ENSGGOP00000012565 XP_018877150.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]