SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018880353.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018880353.1.27298
Domain Number 1 Region: 120-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.12e-158
Family Calponin-homology domain, CH-domain 0.00000000282
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 7.26e-20
Family Calmodulin-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018880353.1.27298
Sequence length 629
Comment PREDICTED: plastin-1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKIL
SVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
SEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAGWHTISNFSQDIKDSRA
YFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPADVVSGN
PKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSD
LADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIA
GQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSIS
SFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYA
LPDDLVEVKPKMVMTVFACLMGKGLNRIK
Download sequence
Identical sequences A0A2J8TT78 G3QK38 H2QNI7 Q14651
ENSP00000336831 ENSP00000336831 ENSP00000387890 ENSP00000418700 NP_001138791.1.87134 NP_001138791.1.92137 NP_001165783.1.87134 NP_001165783.1.92137 NP_002661.2.87134 NP_002661.2.92137 XP_001162294.1.37143 XP_003826563.1.60992 XP_004037833.1.27298 XP_004037834.1.27298 XP_006713723.1.92137 XP_009444870.1.37143 XP_011511202.1.92137 XP_011511203.1.92137 XP_011511205.1.92137 XP_016797593.1.37143 XP_016862115.1.92137 XP_016862116.1.92137 XP_018880353.1.27298 ENSP00000336831 ENSP00000387890 ENSP00000418700 9598.ENSPTRP00000026659 9606.ENSP00000336831 ENSPTRP00000026659 ENSPTRP00000026659 gi|223718246|ref|NP_002661.2| gi|223718250|ref|NP_001138791.1| gi|288915536|ref|NP_001165783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]