SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018882387.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018882387.1.27298
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000247
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 2 Region: 274-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000595
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018882387.1.27298
Sequence length 414
Comment PREDICTED: coiled-coil domain-containing protein 103 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MHLALTTVLLWAWGSLQAFEIVEKENIFQKTPCPAFLMFENAAYLADMSFELPCHCKPEE
VPAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLTRFSIRMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQNSEGMVATFQDEGQEPFADEYYGHLHVFTTFWEWTLCD
RCGVRGEQWRIGLCYLQSPDLSPRYLKSVPDVVSCGSRAVPRKLRTKARDHTPEVLVRSC
LVPCEKTKTFREGVLAIINYVSKVGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVA
WDKDRQHLYRTQYLKGVNRSMRVFIDHGNQLHIRFTQLDDRGIYYCWRQGVLVAGFRLGV
TSRGRYPASFSDPETRSAVELTLIGYLLITAVFVTIHLCRCCCYLFHCCPNFSP
Download sequence
Identical sequences ENSGGOP00000028606 XP_018882387.1.27298 ENSGGOP00000028606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]