SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018891385.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018891385.1.27298
Domain Number 1 Region: 595-850
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 294-524
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 10-210
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-41
Family YWTD domain 0.00000644
Further Details:      
 
Domain Number 4 Region: 897-1154
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-37
Family YWTD domain 0.0000779
Further Details:      
 
Domain Number 5 Region: 1285-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1247-1283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1207-1245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 550-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 853-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 249-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000533
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1164-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018891385.1.27298
Sequence length 1565
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MVCFCPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVS
EEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRK
VLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTID
LEEQKLYWADAKLSFIHRANLDGSFRILLPLQRPSLFMMHLGLFTWNCRRSSSGTFSHSV
LVFPVHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRT
DLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTL
VNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVM
GLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVI
NVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMG
LKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFT
SRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVE
HVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDP
TKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIES
SNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVM
DILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLF
SQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQP
FVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLHGDRDKPR
AIIVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVD
ADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTR
IQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNL
LTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQC
VDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMC
EITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGT
PHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTK
ATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDS
DYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSP
CTDSS
Download sequence
Identical sequences XP_018891385.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]