SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018893156.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018893156.1.27298
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000154
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018893156.1.27298
Sequence length 355
Comment PREDICTED: vacuolar protein sorting-associated protein 37C [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAEQNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPAR
PVPQRTPPVVEEQPQPPSAMPPYPLSYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQPGPRGAAGYSWSPQRSTPPRPGYPRTPTGASGPGYPLGGGRVPSPGYPQQS
PYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGPAWPGY
Download sequence
Identical sequences G3RKU8
ENSGGOP00000016380 XP_018893156.1.27298 XP_018893157.1.27298 ENSGGOP00000016380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]