SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018894603.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018894603.1.27298
Domain Number 1 Region: 615-870
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-56
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 4-263
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-54
Family YWTD domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 314-560
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 918-1177
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-39
Family YWTD domain 0.0000396
Further Details:      
 
Domain Number 5 Region: 872-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000898
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 570-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 1308-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000125
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1229-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1270-1306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 266-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000773
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1187-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018894603.1.27298
Sequence length 1596
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MTAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKR
TEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQEL
DQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLY
WADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEG
LREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLL
ENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWT
DDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMR
KILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLAL
DYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIER
VHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIG
FELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIY
WTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQ
HRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLT
IDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIER
ANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCP
AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDK
QLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNV
INVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLF
FSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWL
YWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHI
CLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECE
DHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQ
CIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRM
LCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSG
PPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSY
RPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQY
LSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_014202583.1.60992 XP_018894603.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]