SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018929249.1.5815 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018929249.1.5815
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-45
Family G proteins 0.0000182
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000902
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018929249.1.5815
Sequence length 279
Comment PREDICTED: ras-related protein Rab-40C isoform X1 [Cyprinus carpio]; AA=GCF_000951615.1; RF=representative genome; TAX=7962; STAX=7962; NAME=Cyprinus carpio; AL=Chromosome; RT=Major
Sequence
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILDSLQDGSAESPYAYSSGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIREIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNGMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKFWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRS
YSLANAAGGSKSNSLKRSKSIRPPQSPPQNCTRNNCKIS
Download sequence
Identical sequences XP_018929249.1.5815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]