SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018948985.1.5815 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018948985.1.5815
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-54
Family YWTD domain 0.00000437
Further Details:      
 
Domain Number 2 Region: 180-419
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-51
Family YWTD domain 0.00000184
Further Details:      
 
Domain Number 3 Region: 783-1036
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-38
Family YWTD domain 0.0000576
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-27
Family YWTD domain 0.0000679
Further Details:      
 
Domain Number 5 Region: 1090-1128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1168-1203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 1130-1165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 437-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000189
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 134-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000847
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 11 Region: 1048-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018948985.1.5815
Sequence length 1448
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 5-like [Cyprinus carpio]; AA=GCF_000951615.1; RF=representative genome; TAX=7962; STAX=7962; NAME=Cyprinus carpio; AL=Chromosome; RT=Major
Sequence
MYWTDWGEEPRIERAGMDGSSRQIIVQKEIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGTAREAVVEGSLTHPFALTLYEETLYWTDWQTRSIHACNKHTGENRREILSGIYSPMDI
QVLGQERQPNIQTPCSERNGGCSHLCLLSPMPPFYSCACPTGVKLKEDGKTCRPGAEQVL
LLARRTDLRRISLDLPDYTDIVLQVSDIRHAIAIDYDPVEGYIYWTDDEVKAIRRARIDG
SDAHTLVTSEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRRILISENLDEPRAI
VLDPINGYMYWTDWGEMPKIERANLDGMDRVVLLNTSLGWPNGLAIDYIAGKLYWGDAKT
DKIEVINVDGTNRMTILEDKLPHIFGFTLLGEYIYWTDWQRRSIERVHIANATREVIVEQ
LPDLMGLKATKVSETFGTNGCAENNGGCSHLCFHRPPGLSCACPMGLELLSDLRTCVVPE
AFLLFTNRADIRSISLGTNSNDVPIPLTGVKEVTALDFDVLENRIYWTDVITKTISRAFM
NGSLVEPVIEFGLDYPEGMAVDWMGRNLYWADTGTNRIEVARLDGQYRQVLVCKDLDNPR
SLALDPASGYMYWTEWGGRPRIARAHMDGSNIVTLVDKVGRANGLTIDFIDQRLYWTDLD
TCMIESTNMQGLQREIVADDLPHPFGLTQYRDYIYWTDWNLRSIERADKRSGLNRTVVQG
HLEYVMDILVFHSSRQDGANECSQNNGNCAHLCLASPSGAQCRCASHYTLEANGRNCSSP
SSFLLFSQKSSISRMVLGEQSPDMILPIHVMKNLRAISFDPLEHLVYWVDGRQNIRRARD
DGSQASTVMTPTNLHPKQPHDLSLDPYSRTVYWTCETTNTINIHRMDGHVIGEVLKDDVD
KPRAIVVNAEKGYMYFTTVQDRSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKLF
WVDTDLKRIESSDLSGANRIVLQDSNILQPVGLTVLGDHLYWIDKQQQMIECVDKLTGEK
RTRIQGRLQYLTGIHAVEYMEPEEFASHPCSRDNGGCSHICIAKGDGTPRCSCPMHLVLL
QNLLSCGEPPTCSSEQFTCATGEIDCIPMAWRCDGIAECADHSDEMNCPICSELQFQCDK
GQCVDSQMRCNGEPDCADGSDEQDCDTICMPNQFRCSNNQCILKKQQCDSFADCTDKSDE
LFCDLPLPPNDIPRHTSTIGPVIGIILSVFVMGGMCFVCQRVVCRHYKGPNGGFPHEYIS
GTPHVPLNFIAPTNSQHGTFTGISCGKSMMSSVSLMGSSSSGAPLYDRNHVTGASSSSSS
STKGAFYPQMLNPPPSPATDRSLYNAEVFYSSNSPSTTRSYRPYLMRGVAPPXTPCSTDV
CDSDYTTSRWKSNKYYMDLNSDSDPYPPPPTPRSQYMSAEESCPPSPSTERSYFHLCPPP
PSPCTDSS
Download sequence
Identical sequences XP_018948985.1.5815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]