SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018985217.1.12885 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018985217.1.12885
Domain Number 1 Region: 241-486
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-71
Family Capz beta-1 subunit 0.000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018985217.1.12885
Sequence length 505
Comment hypothetical protein BABINDRAFT_13490 [Babjeviella inositovora NRRL Y-12698]; AA=GCF_001661335.1; RF=representative genome; TAX=984486; STAX=45609; NAME=Babjeviella inositovora NRRL Y-12698; strain=NRRL Y-12698; AL=Scaffold; RT=Major
Sequence
MGKVAAKKQKITAEKAQSTKKVEVEEQRTESEAELEDLEALSDDDLAEDDELNLDGVSSD
ESSAAEADSEEEESTDDFETELPLMKKKKNKDDGSAQFADALSAIVGSRLKAYDRKDPIL
ARSKLTIKKFENDKLDAKAKRLISAEKKITLDIDRVKTLLPAADNEKAGEILAKERRLKK
VAQRGVVKLFNAVLSTQVKTHTELGTQKIIGQTKKEEMMTEISKEKFLDLVQAAADKTKE
SEEAFDASLDLLRRLDPQNIQSNLNNICRVAPGLAEDLLSSIDTPLSALRDPTNGKAYLC
CDYNRDGDSYRSPWSNEYHPAADADAPAPSRELRELEVFANASFDVYRDLYYEGGVSSVY
LWDQGDGLESDGFAGVVLLKKDSDDSSSSWNSIHVVEVTPEGASATYAITSTIILDLHSA
KTIDLSGNLVRQTEKTLATGDLSSHISNIGTLIEEIETKLRNMLQEVYFGKTRDILGDLR
TTTQASALASEKQRVSEMVKGLSEL
Download sequence
Identical sequences A0A1E3QQA7
XP_018985217.1.12885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]