SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019017863.1.70258 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019017863.1.70258
Domain Number 1 Region: 14-416
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.7e-88
Family IF2B-like 0.0000000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019017863.1.70258
Sequence length 425
Comment hypothetical protein PICMEDRAFT_11726 [Pichia membranifaciens NRRL Y-2026]; AA=GCF_001661235.1; RF=representative genome; TAX=763406; STAX=4926; NAME=Pichia membranifaciens NRRL Y-2026; strain=NRRL Y-2026; AL=Scaffold; RT=Major
Sequence
MSLQAIKFSATPEVSLSILNQLQVPYQSKYIAIDSIAPLPGVTKFSGYEAIKGMYTRGAP
AIMLVGCFSIVVELNRVLHSDIGSAQQYKYNLNDAESFKRRLLERIDELIKSRPTAVNLA
NGCEEIKKIVVSEKNSDLELLYNRILQFSENLYKEDYQSNINIGKNGLQYIKDVLKKENF
KGPFSVMTICNTGSLATSGYGTALGIIRHLHQYLSKDKSTDQFYFEHAYPCETRPYNQGS
RLTAYELQYEKIPFTLITDNMPSFLIDNLNRKEQHTNQGALASLASNAPIRFIIVGSDRI
VKNGDLANKIGTFQLSLLSKLYDEIKFIGAAPTTTIDYNTKSGEDIKIEERPKDELTMVL
GAKMNGNSFAEDKESKDVVLERVRMAPLDIGVWNPSFDVTPHQNIDCIVTEKEYLVKDSS
GVFHL
Download sequence
Identical sequences A0A1E3NKV5
jgi|Picme1|80943|CEP25523_3169 XP_019017863.1.70258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]