SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019070638.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019070638.1.44838
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.73e-19
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 158-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000122
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019070638.1.44838
Sequence length 276
Comment PREDICTED: B3 domain-containing protein REM9-like [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MKIPPKKPHFFKPIQPGFKNGLKIPIGFLKYLKGNDNVEHAILKRGGYKWSMKVNGHRFE
AGWVEFVEQHGLKLGNILMFRHEGNMEFEFSIFDSSHCDREYVEYMEEVGDHTREEISKK
FKFKEDATERPRQKIKSSRKTSSHIIKVANHHKSFGHSHVECTIREYNISRGYLHLPRQF
AYANGLANKKCDLIIRDERQRSWNVKLSSSKTRSYISGCGRTKFFADNCLNKGDCIMFEV
VTNGETPIWKFQVTYREVPLQMFQGKFSHVTNLLFL
Download sequence
Identical sequences K4CID7
Solyc08g006490.1.1 XP_019070638.1.44838 Solyc08g006490.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]