SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019126731.1.61708 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019126731.1.61708
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-55
Family YWTD domain 0.00000412
Further Details:      
 
Domain Number 2 Region: 21-279
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-53
Family YWTD domain 0.000002
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-52
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 937-1198
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-39
Family YWTD domain 0.0000349
Further Details:      
 
Domain Number 5 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 6 Region: 892-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000464
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1248-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 287-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000054
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 1206-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000894
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019126731.1.61708
Sequence length 1549
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Larimichthys crocea]; AA=GCF_000972845.1; RF=representative genome; TAX=215358; STAX=215358; NAME=Larimichthys crocea; AL=Scaffold; RT=Major
Sequence
MGAVLRSLLLSTLCVLVRGVPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYVY
SQGLIYWSDVSEEAIKRTVFNQSGASAIQTVVPGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDK
EIYWPNGLTLDYSQEKLYWADAKHNFIHRCNLDGSSREVVVKGELPHPFALTLYEDTLFW
TDWNTRSIHSCRKQTGAEQRVVHSDIFSPMDIHVFSAKRQNILVDSPCSVKNGGCSHLCL
LSPLKPFYQCACPTGVQLLEDGKTCRDGATQMLLLARRTDLRRISLDMPDFTDIILQVDD
IRHAIAIDYDPVEGYIYWTDDDVKAIRRSLLDGSDAQFVVTSQVNHPDGIAVDWIARNLY
WTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDG
MERVVMVNTSLGWPNGLALDYDERKIYWGDAKTDKIEVMNMDGSGRRVLVEDKLPHIFGF
TLLGDFIYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATYVHRASGTNPCAENNGG
CSHLCLYKPQGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPL
TGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIADDLPHPFGL
TQYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNG
HCSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDII
LPIHSLKNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVSSSLGGPSQGLQLYD
LSIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLE
RSPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIV
IADSNILQPVGLTVFENHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELD
MREYGKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPEHFSCTS
GEVDCIPQAWRCDGYPECDDSSDEEDCPVCSESEFQCDSRQCIDLSLRCNGEINCQDRSD
ENKCEGEPARCPPDQFTCSNGQCIGKHKKCDHNMDCTDSSDEIGCFPTEEPPPPPNTTIG
SIVGVVMALFVVGAVYFVCQRVLCPQMKDDGETVTNDFVVHGPSVPLGYVPHPSSLSSSL
PGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRS
QYTMEFGYSSNSPSTHRSYRYTHNTHILQVHCTRRRTTQRFPPTRRPCA
Download sequence
Identical sequences XP_019126731.1.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]