SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019201901.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019201901.1.78416
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-24
Family SH2 domain 0.000013
Further Details:      
 
Domain Number 2 Region: 153-200
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000641
Family SOCS box-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019201901.1.78416
Sequence length 201
Comment PREDICTED: suppressor of cytokine signaling 2 isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MTCQSSESTETIEGDRRADNNTGAVESDESRVAAAMKELRNTGWYWGSLTANEAKEILQD
TAEGTFLLRDSSQRDYLFTISAMTSAGPTNLRIVFNHGKFKLDSVVLVKPKLKQFDSVVH
LVEYYVQLSRSRDKAAASNSQVSPVPPNGTVQLLLTKPVYTSTPSLQHLCRIAINQRTRQ
VQDLPLPNRLKDYLTDYAYNV
Download sequence
Identical sequences I3JKU5
NP_001298247.1.78416 XP_003448796.1.78416 XP_019201899.1.78416 XP_019201900.1.78416 XP_019201901.1.78416 XP_019201902.1.78416 ENSONIP00000009489 ENSONIP00000009489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]