SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019210467.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019210467.1.78416
Domain Number 1 Region: 36-63,182-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-62
Family G proteins 0.0000000163
Further Details:      
 
Domain Number 2 Region: 67-188
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 7.59e-35
Family Transducin (alpha subunit), insertion domain 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019210467.1.78416
Sequence length 378
Comment PREDICTED: guanine nucleotide-binding protein G(olf) subunit alpha isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MGCLGGKTDEERLDEKAKREANKKIEKQLQRERQTYKATHRLLLLGAGESGKSTIVKQMR
ILHVDGFNAEEKQQKVQDIRKNVKDAIVTIVSAMTILAPPIPLGNPGNQFRADYIKSIGP
LSDFEYTEEFFEHAQKLWEDDGVKACFERANEYQLIDCAQYFLDRLDSVRRPDYSPTDQD
LLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMV
IREDNSTNRLRESLDLFRSIWTNRFLKTISVILFLNKQDVLAEKILAGKSKLEDYFPEYN
NYQLPADAVPDNDEDPKVMRAKFFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVF
NDCRDIIQRMHLRQYELL
Download sequence
Identical sequences I3JU66
ENSONIP00000012411 ENSONIP00000012411 XP_003459474.1.78416 XP_019210467.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]