SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019270758.1.44245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019270758.1.44245
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-56
Family YWTD domain 0.00000539
Further Details:      
 
Domain Number 2 Region: 180-415
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-38
Family YWTD domain 0.0000722
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-28
Family YWTD domain 0.0000845
Further Details:      
 
Domain Number 5 Region: 1171-1206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.022
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000354
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019270758.1.44245
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Panthera pardus]; AA=GCF_001857705.1; RF=representative genome; TAX=9691; STAX=9691; NAME=Panthera pardus; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKKTGEKRKEILRALYSPMDI
QVLSPERQPYFHTRCAEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGQERHVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKATRDVIIDQ
LPDLMGLKAVNVAKVVGTNPCADKNGGCSHLCFFTPRATKCGCPIGLELLSDTKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGQNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYVYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSDMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQG
HLDFVMDILVFHSSRQDGLNDCTHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPP
TTFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPFVLTSPSQSQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLNGDAMGVVLRG
DRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNRLG
KLFWVDADLKRIESCDLSGANRLTLEDASIVQPVGLTVLGQHLYWIDRQQQMIERVEKTT
GDKRTRVQGRVAHLTGIHAVEDISLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFP
CARGQCVDLRLRCDGEADCQDRSDEADCEAVCLPNQFRCASGQCVLIKQQCDSFHDCIDG
SDELMCEITKPPSDDTPAHGSAIGPVVGIILSLFVMGGVYFVCQRVVCQRYTGANGPFPH
EYVSGTPHVPLHFIAPGGSQHGPFTGISCGKSVMSSVSLMGGRGGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNVDMFYSSNIPTTARPYRPYIIRGMAPPTTPCS
TDVCDSDYSANRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLF
PPPPSPCTDSS
Download sequence
Identical sequences XP_019270758.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]