SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019340745.1.47583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019340745.1.47583
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-56
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 29-289
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-54
Family YWTD domain 0.00000188
Further Details:      
 
Domain Number 3 Region: 340-570
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 943-1202
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-39
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 5 Region: 1333-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000022
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 899-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000275
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 1295-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1255-1293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 10 Region: 294-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000649
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1212-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000407
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019340745.1.47583
Sequence length 1613
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X2 [Alligator mississippiensis]; AA=GCF_000281125.3; RF=representative genome; TAX=8496; STAX=8496; NAME=Alligator mississippiensis; AL=Scaffold; RT=Major
Sequence
MEAAPPPRPLLLLLLLLLPRDSGSAAASPLLLFANRRDVRLVDAGRTKLESTIVVSGLED
AAAVDFQYSQGIVFWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGRKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSS
TRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDIQVLSPERQPYFHTPCEEKNG
GCSHLCLLSPRDPFYSCACPTGVQLEHDGKTCKAGAEEVLLLARRTDLRRISLDMPDFTD
IILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKI
ECAYLDGSERRVLVNTSLGWPNGLALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDK
LPHIFGFTLLGDYIYWTDWQRRSIERVHKTRASRDIIIDQLPDLMGLKAASVTKVFGTNP
CAENNGGCSHLCFFTPQETRCACPLGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNN
NDVAIPLTGVKEASALDFDVSDNRIYWTDISLKTISRAFMNGSSVEHVIEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKP
RIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTNGKNRTLIQGHLDFVMDILVFHSSRQDGLN
DCVQNNGHCGHLCLAIPNGYRCGCAAHYALDPNSRNCSSPSSFLLFSQKSAISRMIPDDQ
QSPDIILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNP
EKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGEAIGMVLRGDHDKPRAIVVNAERGYMY
FTNMQERAPKIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLS
GANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKTNGSRRSRIQGRIAHLTGIH
AVEELDMEEFSAHPCSRDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPD
QFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSAAQFQCEKGQCIDARLRCNGEID
CQDKSDEADCDTICLPNQFRCASGQCILRKQQCDSFPDCIDGSDELMCEKNKPPADEPQP
HSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNGPFPHEYVSGTPHVPLNFIAPGS
SQHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPP
SPATDRSLYNTEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKTNKY
YIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_019340745.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]