SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019399414.1.79039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019399414.1.79039
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-56
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 30-289
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-56
Family YWTD domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 340-575
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-49
Family YWTD domain 0.00000356
Further Details:      
 
Domain Number 4 Region: 944-1202
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-40
Family YWTD domain 0.000038
Further Details:      
 
Domain Number 5 Region: 898-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000323
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1255-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 596-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000389
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 1296-1332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 292-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 1334-1372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 1213-1266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000453
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019399414.1.79039
Sequence length 1621
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Crocodylus porosus]; AA=GCF_001723895.1; RF=representative genome; TAX=8502; STAX=8502; NAME=Crocodylus porosus; AL=Scaffold; RT=Major
Sequence
MEEDNEFVTMNVGFTKFTEIFNPVEILSAPLLLYANRRDLRLVDAANGKENATVVVGGLE
DAAAVDFVFVQGLIYWSDVSEEAIKRTDFNKTGSVQNVVVSGLLSPDGLACDWLGEKLYW
TDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGS
SRSVIINTDIYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALT
LFGDMLYWTDWNTHSILACNKYSGEDLHEVHSNIFSPMDIHAFNQQRQPNATNPCGTNNG
GCSHLCLMSPTKSSYQCACPTGVQLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTD
IVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFVDGSGCQFVVTAQIAHPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKI
ERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNSDGTGRRVLVEDK
LPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNP
CADDNGGCSHLCLYRPQGLRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISLETNN
NNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMA
VDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKP
KIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREVIADD
LPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWN
ECASSNGHCSHLCLAVPIGGFVCGCPAHYSLNFDNRTCSAPTTFLLFSQKNAINRMVIDE
QQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKSQEDGSQSLTVVASPVPNQN
LDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSMGVVLKGDQDRPRAIVVNPEKGYM
YFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALAIDSQLGKLFWADSDLRRIESSDL
SGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGQGGRTKVQARIAQLSDI
HAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSP
QQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDSQFQCESGQCVESSLQCNGEA
NCQDNSDEKNCEVLCLTDQFRCASGQCIGKNKKCDHNLDCSDNSDKHGCYTTEEPAPQPN
NTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSS
LSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSP
ATEHSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTTAV
AKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDS
S
Download sequence
Identical sequences XP_019399414.1.79039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]