SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019639962.1.58950 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019639962.1.58950
Domain Number 1 Region: 25-284
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000169
Further Details:      
 
Domain Number 2 Region: 638-886
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-54
Family YWTD domain 0.00000291
Further Details:      
 
Domain Number 3 Region: 336-587
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-53
Family YWTD domain 0.00000278
Further Details:      
 
Domain Number 4 Region: 956-1209
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-36
Family YWTD domain 0.0000303
Further Details:      
 
Domain Number 5 Region: 1263-1302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1341-1378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 594-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 1304-1340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 287-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 10 Region: 1219-1273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000239
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 899-958
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000825
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019639962.1.58950
Sequence length 1635
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like [Branchiostoma belcheri]; AA=GCF_001625305.1; RF=representative genome; TAX=7741; STAX=7741; NAME=Branchiostoma belcheri; breed=outbred; AL=Scaffold; RT=Major
Sequence
MMARAGLLLLGSLCAAFQVALPNPRLLFANRRDVRIIDAGPGRGHNSTVVVSNLEDAAAL
DFIYDQNVIYWTDVSLEMIKMIYTNGSGIVTDVISTGLVSPDGLACDWIGRKLYWTDSET
NRIEVSNLDGTSRKVLFWEELDQPRAIALDPARGYMFWTDWGEVPKIERAGMDGTGRRVV
VDDNIYWPNGLTLDYEEHRLYWADAKLQLIHYANFDGTERRAVVEGSLPHPFALTLYGDT
IYWTDWQTNSIHSCHKISGEDKQVIHSEIFSPMDIHAYMPHRQLNRHANPCQPNNGGCSH
LCLMSPDTPNYRCACPTGVKLLDNNRTCADGASEILLLARRTDLRRISLDTPDYTDVVLQ
IDDIRHAIAIDYDVVEGFVYWTDDEARAIRRARLDGTGVEYLITTEVEHPDGIAVDWVAR
NLYWTDTGTDRIEVTRLNGTSRKILIAENLDEPRAIVLDPSEGYMYWTDWGQHPKIERAE
LDGSHRTVLFNTSLVWPNGLAIDYQARRIYWGDAKTDKIEYANLNGTGRTILVDEKLPHI
FGFSLLGNYIYWTDWQRRSIERVHKTTGDDRQIIVDQLPDLMGLKAVNVQRTDGWNPCVE
NNGGCSHLCLYRPSGVSCGCPMGLELITDMRTCIVPEAFLLFSRRADIRRISLETNNNDV
VIPLPGVKEASALDFDINDNRIYWTDVSLKSISRAFMNGSSAEKIIQFGLDFPEGMAVDW
VAHNLYWADTGTNRIEVARLDGSSRKVLVWQDLDNPRSLALDPAFGFMYWSEWGSDPKIE
RASMDGTDRFILVDSLGRANGLTIDYPERRLYWADLDTNLIESSNMLGNDRKRVIADNLP
HPFGLTQYQDYVYWTDWNTRSIERANKTTGENRTRIQGSLDYVMDIMDILVFHSSRQSGW
NQCAVNNGGCSHLCLATAMPSATSAETAMDLPVMCGCPSHWNLDPDDRTCHPPASFLLFS
QRDLISRMVFDEQQSPDIVLPIHQLRNVKVIDYDRMGEHIYWIDGRIKQLKRAKANGSEV
TSVVPNLDRLFYPIDMAIDEFSRHIYWTCSQTNTINVTRISDLSPVGVVISGDKERPRSI
VLDPTRGYMYWTNMVSNPSIEKAALDGTERQTLFNSDIKQPGPLAIDTKYGMLYWTDIEL
NRIESSGLNGANRQVLVEQMIIQLSGLTIFGDHLYWIDRAKQMIERIDKLTGSGRTRIQA
RLNQLSDIVGVDSKDVIEMNHHPCAVDNGGCSHICIAMKDGRSRCSCPLHLVLFPNELQC
GEPPTCAPDHFTCETGEVDCIPLSWKCDGVAECSDGSDEADCPKCTEDQFTCDSGQCVDG
EMVCNGKEDCMDRSDEMQCHSTCGPDQFLCRNGRCIEKEKRCNNEQDCVDNSDEDDCTDP
TNIRSYGNEDGNSLTIAVVISAIMAVLIIFMMVFVWRRLKRQQEDGFTNDIVMVTNGNVP
TMVALPPSAGTNSLPRSVSGLSTSRGKSATTCLSSSSVPGSGCGPPLYDRTHVTGASSSS
TGSLGTHYPHETLNPPPSPATDRSQYTADLFYSSHSSQSPSTVRSYKHYKFRNVPPPPTP
CTTDGCEDSEPYPLRGLRPKYYDMNYDSDPYPPPPTPRSHYMSDNNCDSCPPSPSTARSY
FHPYVPPPSPATDSP
Download sequence
Identical sequences XP_019639962.1.58950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]