SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019657215.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019657215.1.58354
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-32
Family Calponin-homology domain, CH-domain 0.00085
Further Details:      
 
Domain Number 2 Region: 600-678
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.27e-22
Family DIX domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019657215.1.58354
Sequence length 683
Comment PREDICTED: dixin isoform X1 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLI
EIVAGEKLNGVQLSPSNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVEGNLKSIMRLVL
ALAAHFKPGSSRTVSQGRDFRAPLQSHQPHCATAVAQGAAAALADVCHDVSRSGRDVFRY
RQRNSSVDEEIENPYWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE
KADFVIIPSEGIENRTEETDSPFSRDWRPGSPGTSLETSWEEQLLEQQEHLEKEMEEAKK
MISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKC
KQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL
GEYKKELGQKERLLQQHQAKLEEALRKLSEASYQQVDLERELEQKDVLLAHCMKREADEV
TNYNSHNSQSNGFLLPVAGKGAASITHRGTSDLQLIRDALRSLRDSFGGHDPQHHTIDSL
EQGIASLMERLRAMETQKKQDRRVRGKSPRTQAGSEYRESWPPNSKLSHSQSSPAVSSAC
TKVLYFTDRSLTPFMVNIPKRLGEVTLRDFKAAIDREGNHRYHFKALDPEFGTVKEEVFH
DDDAIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences G1LBW1
XP_019657215.1.58354 ENSAMEP00000004385 ENSAMEP00000004385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]