SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019668348.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019668348.1.62641
Domain Number 1 Region: 639-894
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-56
Family YWTD domain 0.00000547
Further Details:      
 
Domain Number 2 Region: 27-287
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.0000018
Further Details:      
 
Domain Number 3 Region: 338-573
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 941-1200
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-38
Family YWTD domain 0.0000722
Further Details:      
 
Domain Number 5 Region: 1329-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1291-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1251-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 594-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000185
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 897-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family EGF-type module 0.022
Further Details:      
 
Domain Number 10 Region: 293-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000045
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1208-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019668348.1.62641
Sequence length 1609
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MKSAHTLDYVGVHVGYSRLSQHLRASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDAA
AVDFQFSKGAVYWTDVSEEAIKQIYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTD
SETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTR
KIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLS
GDTLYWTDWQTRSIHACNKKTGEKRKEILRALYSPMDIQVLSPERQPYFHTRCAEDNGGC
SHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIV
LQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWV
ARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIEC
ANLDGQERHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLP
HIFGFTLLGDFIYWTDWQRRSIERVHKVKATRDVIIDQLPDLMGLKAVNVAKVVGTNPCA
DKNGGCSHLCFFTPRATKCGCPIGLELLSDTKTCIVPEAFLVFTSRAAIHRISLETNNND
VAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVD
WMGQNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYVYWTEWGGKPRI
VRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSDMLGQERVVIADDLP
HPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDC
THNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQHS
PDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPSQSQNPDRQP
HDLSIDIYSRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNM
QDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNRLGKLFWVDADLKRIESCDLSGANR
LTLEDASIVQPVGLTVLGQHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVED
ISLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFAC
ATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDR
SDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDTPAHGSA
IGPVVGIILSLFVMGGVYFVCQRVVCQRYTGANGPFPHEYVSGTPHVPLHFIAPGGSQHG
PFTGISCGKSVMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPAT
DPSLYNVDMFYSSNIPTAARPYRPYIIRGMAPPTTPCSTDVCDSDYSANRWKASKYYLDL
NSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_019668348.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]