SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019690086.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019690086.1.62641
Domain Number 1 Region: 636-891
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 25-284
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-54
Family YWTD domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 335-574
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-49
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 939-1198
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 893-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1329-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 591-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1250-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1291-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 287-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1208-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000032
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019690086.1.62641
Sequence length 1617
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MQTPSWGSGPSLDTEEPHPGCLSAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAV
DFVFGHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSET
NRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFII
INTEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDT
LYWTDWNTHSILACNKYSGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHL
CLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQL
EDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARN
LYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAAL
DGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNIDGTGRRVLVEDKIPHIF
GFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEEN
GGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAI
PLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLG
KNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRA
AMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPF
GLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASS
NGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPD
IILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQP
YDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNL
QERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANR
IVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKE
LNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTC
FTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDK
SDEKNCEVLCLIDQFRCSNGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGS
VIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSL
PGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERS
HYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVTTAKGY
TSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences M3VTZ9
XP_019690086.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]