SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019715660.1.30352 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019715660.1.30352
Domain Number 1 Region: 65-303
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-90
Family Calponin-homology domain, CH-domain 0.000000986
Further Details:      
 
Domain Number 2 Region: 2201-2314
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-36
Family Pleckstrin-homology domain (PH domain) 0.00000693
Further Details:      
 
Domain Number 3 Region: 322-443
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-34
Family Spectrin repeat 0.0000678
Further Details:      
 
Domain Number 4 Region: 1037-1193
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-30
Family Spectrin repeat 0.0000292
Further Details:      
 
Domain Number 5 Region: 1672-1827
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-29
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1885-2039
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-27
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 842-978
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1250-1403
Classification Level Classification E-value
Superfamily Spectrin repeat 3.64e-27
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 9 Region: 666-770
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-27
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 10 Region: 1566-1722
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-26
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 11 Region: 452-555
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 12 Region: 557-664
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-21
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 13 Region: 774-875
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-21
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 14 Region: 1405-1517
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-17
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 15 Region: 2044-2105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000345
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019715660.1.30352
Sequence length 2387
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X1 [Hippocampus comes]; AA=GCF_001891065.1; RF=representative genome; TAX=109280; STAX=109280; NAME=Hippocampus comes; AL=Scaffold; RT=Major
Sequence
MELQSASSTFSAPLSPTLDYAGPLPPSSPSGVPGPSHGRSRSPMRASSPGPGGGGGFSGQ
AAFNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLSRVSCRITDLYVDLRDGRMLIKLLE
VLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTI
ILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFSTSWRDGMAFNAIIH
KHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTY
YHYFSKMKALKVEGKRIGKVLDNAIETEKMVDKYECLASELLEWIEQTIIILNNRKFANS
LVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDIN
KAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFD
LQAVEAATKKHEAIETDIAAYEERVQAVVSVAKELEAESYHDIKRIAARKDNVIRLWEYL
LELLKARRLRLEQTLGMQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALV
EADIGIQADRVRNVNANAQKFANDSDGYKPCDPQVIRERVAHMEFCYQELSQLAAERRAR
LEESRRLWKFFWEMAEEEGWIREKEQILSSEDCGKDLTGALRLLSQHKAFEDEMSGRAAH
LQQTIKQGEQLVADKHFGADKIRERIQDIQDQWAALERLSAVRKSRLQEACNQHQFQADA
DDMDTWMLDALRIVSSVDVGHDEFSTQALVKKHKDVAEEIASYRPVIDALHEQSHTLPPE
KADSQEVQSRLAGIEERYKEVVELARLRKQALQDALALYKMLSEANACELWIDEKEQWLN
SMDIPDKLEDLEVVQHRFESLEPEMNNQASRVAVVNQVARQLIHSGHPGEKEIKSQQDKL
NTRWSQFRDLVDQKKESLSSALGVQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMA
LQRKLTGMERDLAAIEDKLGDLAKEAERLSSEHPEQSEAIKGRLDEITGVWEEMKGTMKN
REESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLGQHEAIKNEIRN
YEEDYQKMRDMGEMVTRGQTDAQYMFLRQRLQALDTGWNELHKMWENRRNLLSQSHSYQL
FLRDTKQAEAFLRTQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKISGVVDTGR
RLVADGNINTERIQDKVDSIHQRHKKNRAAASELLMRLKDNRDLQKFLQDCQELSLWINE
KMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLDKIQKDGEALMAEKPETEAMVRE
KLASLKKMWEELESSTQTKAKCLFDANKAELFTQSCADLDKWLAGLDAQLQSDDYGKDLT
SVNIMLKKQQMLESQVEVRQKEVDELQSQSQALSQEGKGSDEVDGQRRSVESKFGALRAP
LQSRRDNLMASREIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLIKKNQTLQKE
IQGHQPRYDDIFERSQHILRQERPTGELIRQRLAELRSLWEQIRKETEKRHARLSEAHEA
QQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYADTVHQLSAT
SRGLVAAEHPDSERIGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWI
AEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRLADELINAGHGDAA
TVAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEILARVLDKHKKLPEELGR
DQNTVETLQRMHTAFEHDIQALGTQVRQLQEDAVRLQSAYAGDKADDIQKREGEVLEAWK
SLLEAAEGRRGKLADTGDKFRFFSLVRDLMLWMDDVIRLIDAQENPRDVSSVELLMNNHQ
GIKAEIDARNDSFTACIELGKSLLARKHYASDEIKEKLLQLTDKRKEMIDKWEDRWEWLR
LVLEVHQFSRDAGVAEAWLLGQESYLSSREMGQSVDDVEKLIKRHEAFEKSAATWEERFA
ALERLTTMELLEVRRRQEEEERKNQPAAAEATAAAQPREGEVANQNGPSSEPDSARDDAC
AGGEAVNGVSEPSPAGSPGGARKAKAGQQAATLPARSQQEAPSATSQMEGFLHRKHEWEG
HNKKASSRSWHHVFCVLNHQELGFYKDHKSATQGIPYHGEIPVALQDATCEVALGYKKKK
HVFKLKVTDGNEYLFQAKDDEEMNSWISTISVAILGEKGEVTPSSHSTPAPAATAARAHT
MPTSTGRSVTVPTSASAEVAAAAAAESSPGKRDKDKEKRFSLFSKKK
Download sequence
Identical sequences XP_019715660.1.30352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]