SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019736743.1.30352 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019736743.1.30352
Domain Number 1 Region: 1703-1945
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000621
Family Tropomyosin 0.00071
Further Details:      
 
Domain Number 2 Region: 1528-1729
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000347
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 3 Region: 1114-1352
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000687
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019736743.1.30352
Sequence length 2024
Comment PREDICTED: rootletin isoform X2 [Hippocampus comes]; AA=GCF_001891065.1; RF=representative genome; TAX=109280; STAX=109280; NAME=Hippocampus comes; AL=Scaffold; RT=Major
Sequence
MSAAMSVAENKASDSNKLESVIQRLEESVLSEEKKLTVRGPSPDAPPTCLPARVREIVTK
NLNENSTGAMSSVMSLQEENRVLQGELAKLEDLLAHSRADRDELAIKYSAISERLEQTLR
YDSGDGDHDSPESRSLAQQNVDLRRRLDEEQAAYKRKLTTYQEGQQRQAQLVQRLQAKVL
QYKKRCGDLEQMLQQKSAEFEKPRLSESSETSNGRCPDESNSNLEDALIRLEEEQQRSSS
LSAVNAMLREQLEQASLANEALSQDIRRLTADWTKAREELEQKESDWRREEESFHSHFSS
EHSRLLSLWRQVVGFRRHICELKSATERDLSEMRNELAQASHSAQVSCAGLSATLNTREG
GVTLALESEKALRVQLERQLRERVSEMMNLQARTDAERSELNLRLSDSVREEERLKGKIE
EKERELVLLSRKLEEQSNNDGSDMQLMRAHTETLLDTLRDIAQTVLTDAESSEADQDNTA
APLLAFIHSSSPAAPSRRSSSPSKLTTLSAPSEATLSALRSAVTHKTLLLQDARGRLLSA
QSSIQQLRKQLAEADTARREADQRHLTLQRERDAAQRDKETTQREKDRLRLERDTLASEK
MSLEQSMKAAQNSNQTLQTDCEKLQLLLTSTQREKDHQREEKEAAVLERDRAKAEVQRIQ
KQWDQSESRASAQRGELSTVRETQQQAEAARQLLEKERSQLSEALTRAESSNAELSLLIN
KLQSEDAALRDSLTKMGSMNEALSQDKTDLNTYILQLEDEKALLHTQKREAEQEKMTIRD
ELVRLEQDRMELDSARITLRQSLQDTELTRVGMEAELHSLRAERLKLQEKVTQLCTEVTS
LGSELSLARGVSQQNEAALEEVGRSRAELTRDKASLVVQLTASERENSALSEELSAYRSE
HESLETALFEVQHQLAQVESCKEQLGVDNQNLRARIETATAELRRARSEAESALAQVERE
KHILTQTLNAAHLEAQHALRKASCEHQEEVEKLVTEKEALRQSLTVAHDSALKKLRREVE
EELHKAQKEKEELQSNLTTLLHDRDQSLLQAEAEKQQALSLKEAEKTALCDRVSSLQAEL
SALAVEAERKARAAALCKEQDQARVSALTSELQAVRSQLEGASALHEKDLQSLRETLSDF
QSRADGAVKELNKCKASLAVSEESRDELRRHTLEAERRLNQTQDEAENYRREGTELRRSL
SDALKERDTLSQSNCQLRETLRGAETERISVKRQCEEKEQRLIVLQENFSSSQKEVTELR
SCLREVERSRLEARRELQEMRRQLKVLDAEKDQKGRDVAELQTRLSLEEQREEERGKEVF
TLKHKLTEAEGIQDSLKREVNLFQKRLAESESCWRLCERELTAQLQEARGCEKKLQDEAK
NLTLRAQAAQDSAGVYSLQLSEAQGRLAATEAELTRAEASRRDLEFRLSGLQSALTRTLG
IGAGGRGVRGRSPGGSSASPSPMSRHHSISPLRSSLSPPKEFHTSTPDNTLGSRAVSPER
GGTPLPLSQPELDPDTLRSGLKDFLLELLEAHRERDDALCQLGAVKREVDELRADRDLAQ
SRLAHLQKNLQDYQEGKRGLDERLTHAQLQLHQQEEAVRRGDRERRTLADRVKELERVLQ
ACEAEKKHTQEQLDKQRAAEVRLEAERRRLREALEASEARATRVEVGRRSLEGELQRLRL
SLGDREAESQASHDRHEALLKQVTDGEGRVSLLQTEVEQLSQALLKAEENEAVLREKNAS
LNQSLQELAAAHGSAQSRLTALQKALSMTEQEKQHLQERIDESRSSLSEARRNMATLNER
MHSLQSEVHQSQLQREQVEAEFTKSQEALRQRSASLAEAQRGAQAAQVERAMVEERLRGL
QKAVAMLETEKKDAERQAVRLEKDKNALRNTLDKVERQKLKSEEGSMRLSAERNRLDRSL
NTAEQELQEAQQQILTLQTQMADMEQSHSVCESLVRQRDETQQEAERLRASFRDLERTLG
SRERTHRHRVKGLEEQVSTLKEQLQQEMKRRQPSLPSSFLSTAN
Download sequence
Identical sequences XP_019736743.1.30352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]