SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019739162.1.30352 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019739162.1.30352
Domain Number 1 Region: 53-163
Classification Level Classification E-value
Superfamily FKBP-like 8.64e-35
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 
Domain Number 2 Region: 158-270
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-30
Family FKBP immunophilin/proline isomerase 0.00067
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily FKBP-like 0.000000000000236
Family FKBP immunophilin/proline isomerase 0.0024
Further Details:      
 
Domain Number 4 Region: 277-349
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000851
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019739162.1.30352
Sequence length 363
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP10-like isoform X3 [Hippocampus comes]; AA=GCF_001891065.1; RF=representative genome; TAX=109280; STAX=109280; NAME=Hippocampus comes; AL=Scaffold; RT=Major
Sequence
MCVGEIRNIVIPPFKGYGEKGSAGAEVPPHATLVFDVLLVDIHNPKDNITVEEQVVPESC
NRRTVAGDYIRYHYNGTFLNGVTFDTSYQRNSTYNTYIGMGYVIAGMDQALLGVCMGERR
RVVIPPHLAYGQGGAGDVIPPSAVLVFDIHVVDFHNPSDQVDVQVLHRPEACNHTTEVDD
LVHYHYNCTLVDGTRLFSSHDYENLQDAVLGSDKVIDGLEQALRGMCEGERRMVTVPPHL
GHGEKGAPGVPSSAVLVFDIEMVRVQKGVPPGYLFVWLKETPQDLFQAMDVDKDEAVPQE
EFADFIKLQVSEGKGRLRPGMAAEQVIADMFANQDRDKDGRITAEELKLKVDEDIERAQH
DEL
Download sequence
Identical sequences XP_019739162.1.30352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]