SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019753014.1.30352 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019753014.1.30352
Domain Number 1 Region: 635-890
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000394
Further Details:      
 
Domain Number 2 Region: 334-571
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-53
Family YWTD domain 0.00000377
Further Details:      
 
Domain Number 3 Region: 21-282
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-50
Family YWTD domain 0.00000164
Further Details:      
 
Domain Number 4 Region: 938-1189
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-40
Family YWTD domain 0.0000466
Further Details:      
 
Domain Number 5 Region: 1242-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 6 Region: 893-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 592-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 1319-1355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000641
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 288-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 11 Region: 1199-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019753014.1.30352
Sequence length 1518
Comment PREDICTED: low-density lipoprotein receptor-related protein 6, partial [Hippocampus comes]; AA=GCF_001891065.1; RF=representative genome; TAX=109280; STAX=109280; NAME=Hippocampus comes; AL=Scaffold; RT=Major
Sequence
MAAVLRTLLLSTFCPLVRGEPLLLYANRRDLRLVDASRERANASVVVGGLEDAAAVDYVF
SRGLIYWSDVSEEAIKRTALDRAGGGGGAVHTVVPGLASPDGLACDWLAAKLYWTDSETN
RIEVSELDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEIPKIERAGMDGTNRSVIV
ERDIYWPNGLTLDYEQLKLYWADAKHSFIHRCHLDGTNREVVVRGELPHPFALTLFEDTL
FWTDWTTHSIHSCSKHDGARQRVVHSDIFSPMDIHVFSAKRQTQMSTPCSLNNGGCSHLC
LLSPDTPFYRCACPTGVQLLRDDKTCRDGATRVLLLARRTDLRRISLDTPDFTAIILQVD
DIRHAIAIDYDPVDGYIYWTDDDVKAIRRSLLDGGDAQFVVTSQVNHPDGIAVDWIARNL
YWTDTGTDRIEVTRLNGTMRKILVSEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLD
GTERLVLVNTSLGWPNGLALDYDERKIYWGDAKTDMIEVMNMDGTSRRVLVEDKLPHIFG
FTLLGDFIYWTDWQRRSIERVHKHTAEREVIIEQLPDLMGLKAAYVREAFGSNACAENNG
GCSHLCLFKPQGAQCACPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIP
LTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGK
NLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAQGYMYWTEWGGKPKIDRAA
MDGTGRLTLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIAEDLPHPFG
LTQYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTN
GHCSHLCLAVPVSGFVCGCPAHFSLGYDNKTCNAPTSFLLFSQKTAINRMVMDEQQSPDI
ILPIHNLRNVRAIDYDPLDKQLYWIDSKQNVVRRAQEDGNQSTTVVSGVQLYDLSIDIYS
RFIYWTSELTNVINVTRTDGGRVGVVLRGPHDKPRAIVVNPERGYMYFTNLLERSPTIER
AALDGTEREVLFFSGLGKPVALAVDNELAKLFWVDSDLRRIESSDLSGANRVVIADSNIL
QPVGLTVFGKHLYWIDKQQQMIERIDKTTREGRTKIQARVAYLSDIHAVRELDMREYGKH
PCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPEQFSCRSGEVDCIP
QAWRCDGYAECDDDSDEQDCPVCSESEFQCDSRQCVDLGLRCNGEVNCQDRSDENKCEVR
CPLDQFSCANGQCVGKDKKCDDNMDCDDNSDEMGCSDSTEEPPPSNNTVGSIVGVVMALF
LVGAVYFVCQRVLCPQMKDDSETVANDFVVHGPSSVPLGYVPHAAPLSASLPVMSGGKSA
IGSLSIMGGSSGPPYDRAHITGASSSSSSSTKGAYFPPILNPPPSPATVRSQYTLEFGYS
SNSPSTHRSYSYRPYTYR
Download sequence
Identical sequences XP_019753014.1.30352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]