SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019778743.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019778743.1.83887
Domain Number 1 Region: 155-346
Classification Level Classification E-value
Superfamily E set domains 3.87e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000197
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019778743.1.83887
Sequence length 375
Comment PREDICTED: ATP-sensitive inward rectifier potassium channel 15 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MERINISMARATLVKHTAGAGLKASRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPREHTSNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKQKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKTGKYVADFSQFEQIRKSSDCTFYCTDSEKQKLEEKYRQEDQ
RERELRTLLLQQSNV
Download sequence
Identical sequences ENSTTRP00000014553 XP_019778736.1.83887 XP_019778737.1.83887 XP_019778738.1.83887 XP_019778739.1.83887 XP_019778740.1.83887 XP_019778741.1.83887 XP_019778743.1.83887 ENSTTRP00000014553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]