SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019793207.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019793207.1.83887
Domain Number 1 Region: 505-760
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 204-450
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-49
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 3 Region: 808-1067
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-39
Family YWTD domain 0.000042
Further Details:      
 
Domain Number 4 Region: 1-153
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-26
Family YWTD domain 0.0000643
Further Details:      
 
Domain Number 5 Region: 762-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1198-1236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 460-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000995
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1120-1158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1160-1196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 156-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000658
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1077-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019793207.1.83887
Sequence length 1487
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYKERKLYWADAKLNFIHRSNL
DGTNRGKKGEDCVHLSAVSEQVTIGWTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSI
LACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQ
CACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDY
DPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRI
EVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNT
SLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYW
TDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIVGSNPCAEENGGCSHLCLYRP
QGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASAL
DFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTN
RIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLV
PNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYW
TDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAV
PVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNV
RAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRY
IYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAA
LDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRQIESSDLSGANRIVLEDSNILQP
VGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPC
TQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPVA
WRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCL
IDQFRCANGQCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVS
GTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMIS
SLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSN
SPSTHRSYSYRPHSYRHFAPPTTPCSTDVCDSDYAPSRRIMTSVATAKGYTSDLNYDSEP
VPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_019793207.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]