SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019798221.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019798221.1.83887
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-63
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2085-2202
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-37
Family Pleckstrin-homology domain (PH domain) 0.00000198
Further Details:      
 
Domain Number 3 Region: 188-309
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 904-1059
Classification Level Classification E-value
Superfamily Spectrin repeat 2.57e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 5 Region: 1432-1588
Classification Level Classification E-value
Superfamily Spectrin repeat 2.94e-28
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 6 Region: 1116-1269
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-28
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 7 Region: 532-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-27
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 8 Region: 1751-1905
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 705-844
Classification Level Classification E-value
Superfamily Spectrin repeat 7.74e-26
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 10 Region: 318-421
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-23
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 11 Region: 1591-1696
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 422-530
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 639-739
Classification Level Classification E-value
Superfamily Spectrin repeat 1.9e-20
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 14 Region: 1277-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 15 Region: 1886-1971
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000017
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019798221.1.83887
Sequence length 2256
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X3 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETE
DNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKK
SNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEG
KRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTY
RTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERE
LALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAI
ETDIAAYEERVQAVVAVARELEAENYHDIKRIAARKDNVIRLWEYLLELLRARRQRLEMN
LGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIGIQAERVRGV
NASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEM
AEEEGWIREKEKILSSDDYGKDLTSVVRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE
EHFGSEKIRERIAYIREQWAHLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIV
SSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTIDSLHEQAGALPQEHAESPDVQGRLAGI
EERYKEVAELTRLRKQALQDTLALYKMFSEAGACELWIDEKEQWLDNMQIPEKLEDLEVI
QHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRK
KDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVA
IEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQF
LRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEM
VTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNN
QEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNISSDRIQ
EKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEAR
NLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLES
TTQTKAQRLFDANRAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLEN
QMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMALLEPLNERKQNLLASREI
HQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFER
SQNIVTDSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWM
SEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESER
ISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQ
DYEHVTMLQERFREFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWA
DLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTT
FEHDIQALGTQVRQLQEDAARLQAAYAGDKAEDIQKRENEVLEAWKALLDACEGRRVRLV
DTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFT
TCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASV
AEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVR
RQQEEEERKRRPPSPEPSSKVSEETESQQQWDASKGEQVSQNGLPAEQGSPRMAETVDTS
EMVNGAAEQRTSSKESSPIPSPTSERKAKTTLPAQSAATLPARTQETPLAQMEGFLNRKH
EWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAICEVALDY
KKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQT
LPTSVVTITSESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences XP_019798221.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]