SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019817100.1.53367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019817100.1.53367
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 180-426
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-50
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-39
Family YWTD domain 0.000042
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-28
Family YWTD domain 0.0000361
Further Details:      
 
Domain Number 5 Region: 738-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000785
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000431
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000493
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019817100.1.53367
Sequence length 1462
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Bos indicus]; AA=GCF_000247795.1; RF=representative genome; TAX=9915; STAX=9915; NAME=Bos indicus; breed=Nelore; AL=Chromosome; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSDRFIIINTEIYWPNGLTLDYEERKLYWADAKLNFIHRSNL
DGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDI
HVFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVTLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKT
DKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQ
LPDLMGLKATNVHRVIGSNPCAEDNGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA
PTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRK
AQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGXSIGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALALDS
RLGKLFWADSDLRRIESSDLSGANRIVLEDTNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCP
MHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSES
QFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNLDC
SDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTP
CSTDVCDSDYAPSRRMTSVVTAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSP
YTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_019817100.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]