SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019865213.1.27284 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019865213.1.27284
Domain Number 1 Region: 1388-1592
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000163
Family Tropomyosin 0.0028
Further Details:      
 
Domain Number 2 Region: 1544-1804
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000242
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number 3 Region: 407-606
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000915
Family Tropomyosin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019865213.1.27284
Sequence length 1944
Comment PREDICTED: LOW QUALITY PROTEIN: rootletin-like [Aethina tumida]; AA=GCF_001937115.1; RF=representative genome; TAX=116153; STAX=116153; NAME=Aethina tumida; AL=Contig; RT=Major
Sequence
MNLGDRRRPPVYRPKSRTDSSLSGGRTDGGRLRGDGGGGSSDEDSLRTDLRQRLQEEASL
YRRRLDTYRQAQQNQAALVSRLQAKVLQYKQKCADLEAQLTENVTGFDQPSSLKSTYPVV
PSTPSTSSSALEQAQQHLREMREERITDLDTALRRLDDEKRRSEKLMQLNSTLREQLEES
HSTNEALTADLQKLTNDWETLREEMLMKEDEWKDEEQAFNDYYSTEHNRLLNLWRDVVSV
KRLFMDVQSSTERDLNKIKAEVNGMGKEMILACGRMDSNMFTENILGGKQKYESQQQSSD
LKSEIESLKLQHDAYQTELQMKEDRIQQLLKDIQLLEDRCADAEHNVGQVVKMQEEIDIL
QGALRDIAHALIQDAETKDPEIIQATHLHLSGSTPIPQKSPKRSARSMTSPAAFAESTIS
AVQAALHKYQSFIHELQVKLQTNKEQLLLVRKQFENSEDNVASLEKRAKELVSQLDASRA
HCSQLTQDREVLQKTLDTVKADNATLERNRLEINHMLETLNGDYDKLQKHNNKMQKDLDA
LHDEKVFLQSEIDRLNQDADLREISLRGEEDRCSRMREELLTVREELNKLYLSHDMLEQQ
KLEADNMISNLEKIKLDYEIQLDKALGERSNVHDSLMKKENIASNLELDKKKLQDDLKRL
EDEKSALQHQCNDHQNDIQSLRKELLQAEQLKLDLESDKVSLSEKCKFLEIDKGKIEMEL
NQVTRERNDLSNQLTVLGRKRDAINEELVRTRQRLEQANETNARINRNLEELVKECEEKQ
CTIDAMDKEIQRHQELLAAVRSEKEALEAVLFDTQTNLEASDVKKMQLEQEQQDLLVKQE
QLKSQIARLTKDLERSEKKCVEIKNSFTQQAGNKDVEYKQTVDKLKQQNEENCKKLTEER
EKIRSSLEKRLQQSLQQLGNEKDAEIQRLVDRIEELQNHIENLCQQHEELMLRAENDKQQ
ALLIAHHDHQAVHDKLEATKRELEGERDTLERFRREANGRFEQDRANINQLKEELNKFKT
RLEETKSRYEDEKIKLEQRLEEVKCERDNSQSEVENLKVQLHLVEDKSESVNNQLHETIR
KLKEAENNSESLRKELTDVRRLLGDSNFEKEKYHNTNKELRDHVKRTESEKREQGRQLEE
ALQKIANLDDVKLSLENERNRLQGQIRDLEKDLLQSEHKSQSIHEELQRSQASNSQQQVE
EKELQARLLNEVEERERAHQEVHQLRKQMSELDRNLEQTRQELGRTRSHSAQLEEQWHAR
EQDLLVHLEDSRAREKRLEDQKHNLEVCLVDATQQIQELKAKLGGSEGRVRALEAQLGQL
ETSKRDIEQKLCSVISTLRRIAGVQLDGSVSMPYRLLSPSRRWSPARTHDDGRDGSIDID
PEVVRKGVRNLMQQVAQIERERDDYKTQINSAKKQLQEAHESQSKGDSKLNKVLQSLRSL
QEEKGSLEAKLGQKAIELQSQTEALNKKTDEAKQMRDKIVSLELTVSGGNEQKLHFEDKI
EKMKVALARLEAEKRGLQEELARTENRSTKLELQRMSAEGDLQRLQMMLQEKDGTIQKLQ
EKCDAQSRSVASLEERCVSLKSTIDQLNLSLERAATTESDLKSELSSLQRSLMETTSVSH
SSSEKLKHLQKSLANSENERRVVTERMEATQQNLAEMRRNNQILQDQVTRLNNELANNEV
QRSGLESQLRLAQWPQDTAISGHEEEELRTQLHMISRDRNELRGKVDALNNKVRQLEAEK
RSLERSAKTPSMTVRSKSYERPEKYEADSSITEMDHRYEQENRELKIKISRLESELLDKE
AELNRLRNQRPGLDSKFDRAEIERYRAAQLQAERLLEAREQSHRQQVARLENQITLLRDQ
LNQEIKRRQQYVLRSSKAGREMQQLRQALGDSLRTVSQDPSLDALLLEHEARKLDNTLSN
TASLPPALGLPSSTYRRSTTPQPK
Download sequence
Identical sequences XP_019865213.1.27284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]