SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019908775.1.71217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019908775.1.71217
Domain Number 1 Region: 21-284
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-52
Family YWTD domain 0.0000015
Further Details:      
 
Domain Number 2 Region: 335-573
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-50
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 810-1071
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-40
Family YWTD domain 0.0000389
Further Details:      
 
Domain Number 4 Region: 644-762
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000902
Family YWTD domain 0.0008
Further Details:      
 
Domain Number 5 Region: 1200-1238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1121-1161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 7 Region: 765-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000497
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1162-1198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 592-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000681
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 289-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 11 Region: 1079-1131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019908775.1.71217
Sequence length 1490
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6 [Esox lucius]; AA=GCF_000721915.3; RF=representative genome; TAX=8010; STAX=8010; NAME=Esox lucius; AL=Chromosome; RT=Major
Sequence
MGAVLRTLLLCSFCLLIRGGPLLLYANRRDLRLVDASRGRANATVVVGGLEDAAAVDYVY
AQGLVYWSDVSEEAIKRTVFNQSGPGGTATQTVVLSGLASPDGLACDWLGRKLYWTDSET
NRIEVAELDGSLRRVIFWEDLDQPRAIALDPVRGYMYWTDWGEVPKIERAGMDGTNRAMI
IDKEIYWPNGLTLDYNQEKLYWADAKFNFIHRSNLDGTGREVVVKGDLPHPFALTLYEDT
LFWTDWKTRSIHSCQKDTGEDQRNVHSDIFSPMDIHVYSQKRQPQLSTPCSVRNGDCSHL
CLLSPNKPSYQCACPTGVQLLEDGRTCRNGATQLLLLARRTDLRRISLDTPDFTDIILPT
DDIRHAIAIDYDPVDGHIYWTDDEVRAIRRSSLDGSDAQFIVTSQVNHPDGIAVDWIARN
LYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWSDWGGVPKIERADL
DGLERVVMVNTSLGWPNGLALDYVDRMIYWGDARTDKIEMIGMDGSGRRVLLDDKLPHIF
GFSLLGDFIYWTDWQRRSIERVHKHTAEREVIIDQLPDLMGLKATYVHKTFGTNPCAEAN
GGCSHLCLYKPTGVQCACPIGLELISDLSTCIVPEAFLLFSRHTDIRRISLETNHNNVAI
PLSGVKEASALDFDVTDNRIYWTDITLKTNGSLCPPGLEREVIADDLPHPFGLTQYQDYI
YWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNGHCSHLCL
AVPISSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKSAINRMVMDEQQSPDIILPIHSLR
NVRAIDYDPLDKQLYWIDSKLNVIRRAQEDGNMSMTVVSSNVGSPNLGLQPFDLSIDIYS
RFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLQERSPKIER
AALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLTGANRIVIEDSNIL
QPVGLTVFGNHLYWIDRQQQMIERIDKTTREGRTKIQARIATLSDIHAVHDLDMREYSKH
PCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPEQFSCASGEVDCIP
KAWRCDGFPECDDHSDERDCPLCSPSEFQCDSTQCVDLSLRCNGEDNCQDRSDENKCEVH
CSPDQFSCSNGQCVGKHQKCDHFPDCSDNSDEIGCYSTEEPSTPPTNTIGSIVGVVMALF
VVGAVYLVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSGSLPGMSRGKSV
IGSLSIMGGSSXPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQYTLEFGYS
PTVKHTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRHAPTTSNSAVAKGYTXDLNY
DSEPLPPPYPRSSTCQQKENCESCPPSPYTERSYAHHLLPPPPSPCTDSS
Download sequence
Identical sequences XP_019908775.1.71217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]