SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019941464.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019941464.1.63745
Domain Number 1 Region: 6-69
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.44e-21
Family Transducin (heterotrimeric G protein), gamma chain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019941464.1.63745
Sequence length 75
Comment PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MKGDTPVNSTMSVGQARKLVEQLKIEASFCRIKVSKAAADLMAYCDAHSCDDPLITPVPT
SENPFREKKFFCALL
Download sequence
Identical sequences H2RUY9 Q4SCQ2
ENSTRUP00000003957 ENSTNIP00000013715 ENSTRUP00000003957 XP_003971110.1.43653 XP_010738457.1.61708 XP_019941464.1.63745 XP_020498977.1.8198 31033.ENSTRUP00000003957 99883.ENSTNIP00000013715 ENSTNIP00000013715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]