SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_019946447.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019946447.1.63745
Domain Number 1 Region: 69-182
Classification Level Classification E-value
Superfamily FKBP-like 1.06e-37
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 
Domain Number 2 Region: 182-291
Classification Level Classification E-value
Superfamily FKBP-like 1.63e-35
Family FKBP immunophilin/proline isomerase 0.00032
Further Details:      
 
Domain Number 3 Region: 3-72
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-21
Family FKBP immunophilin/proline isomerase 0.0012
Further Details:      
 
Domain Number 4 Region: 299-371
Classification Level Classification E-value
Superfamily EF-hand 0.000000000109
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019946447.1.63745
Sequence length 383
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MRTYDTYVGIGWLIAGMDQGLLGMCVGERRIVTMPPSLGYGENGDGSDIPGQASLVFDIV
LLDLHNPRDGITVTNQKVPESCTRKSVAGDFVRYHYNGSLLDGTFFDSSYSRNRTYDTYV
GRGYVIAGMDEGLIGVCVGEKRTITIPPHLGYGEEGTGTKIPGSAVLVFDIDIIDFHNPS
DSTEITVTHKPGECDKQTKKGDFIKYHYNASMMDGTSIDSTYNYGKTYNIVLGANQVVPG
MEDGLLDMCVGEKRHLVIPPHLGYGERGVPDEVPGSAVLLFDIELVEMEEGLPEGYMFIW
NDDVSPDLFAEMDKDENKQVEPSEFTDYIMRQVSEGKGRLAPGFDPYRIIDNMFSNQDRD
GDGKITEAEFKLKADEATTHDEL
Download sequence
Identical sequences XP_019946447.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]