SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020145489.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020145489.1.48125
Domain Number 1 Region: 91-203
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-37
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 199-302
Classification Level Classification E-value
Superfamily FKBP-like 1e-33
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 3 Region: 14-89
Classification Level Classification E-value
Superfamily FKBP-like 7.86e-24
Family FKBP immunophilin/proline isomerase 0.0013
Further Details:      
 
Domain Number 4 Region: 308-384
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000013
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020145489.1.48125
Sequence length 395
Comment peptidyl-prolyl cis-trans isomerase FKBP9 isoform X3 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MNVFEGWRGMGHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDG
KDIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLF
DSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVL
VFDIHVIDFHNPADSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKT
YNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLE
LVAGLPEGYMFVWNGEVSPNLFDEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAE
MIMKNMFTNQDRNGDGKVTAEEFKLKDQETKHDEL
Download sequence
Identical sequences XP_020145489.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]